KEGG   Bacillus subtilis subsp. subtilis 168: BSU11390
Entry
BSU11390          CDS       T00010                                 

Gene name
appB
Definition
(RefSeq) oligopeptide transport system permease protein AppB
  KO
K02033  peptide/nickel transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11390 (appB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11390 (appB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BSU11390 (appB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N
Other DBs
NCBI-GeneID: 936400
NCBI-ProteinID: NP_389021
Pasteur: BG11088
BSORF: BG11088
UniProt: P42062 A0A6M4JHB5
Position
1215243..1216193
AA seq 316 aa
MAAYIIRRTLMSIPILLGITILSFVIMKAAPGDPMTLMMDPKISQADREQFIEKYGLNDP
QYVQYLKWLGNMVQGDFGTSIVRKGTPVSELIMARLPNTLLLMLVSTILALMISIPFGVL
SAKRPYSKIDYGITFTSFIGLAIPNFWFGLILIMVLSVNLGWFPTGGVETLNTEFNIFDR
IHHLILPAFVLATADMAGLTRYTRSNMLDVLNQDYIRTARAKGFKENRVLFKHGLRNALL
PVITIFGLMIPSFIGGSVVVEQIFTWPGLGKLFVDSAFQRDYPVIMAMTVISAVLVVVGN
LIADILYAIVDPRIEY
NT seq 951 nt   +upstreamnt  +downstreamnt
atggctgcatatattatcagaagaaccttaatgtctatcccgattttattgggaattacg
attttatcatttgttatcatgaaagccgcgcccggagatccgatgacattaatgatggac
ccgaaaatcagccaggctgacagagagcagtttattgaaaaatacggtctgaatgatcct
cagtacgttcaatatttaaagtggctaggcaacatggtgcagggtgatttcggaacgtct
attgtcagaaaaggaacgcctgtttcagaattgattatggcaagactacccaatacgctc
ctgctgatgctggtttcaacgattttggctcttatgatttctattccgttcggtgtcctg
tcggcaaagcggccgtattcaaaaatcgactatggcattacatttacctcgtttataggc
ctggctattccaaacttttggtttggattaattttgattatggtgttatcggtaaatctc
ggctggtttccaactgggggtgtcgagacactgaataccgaattcaatatatttgaccgg
attcatcatttaattctgcctgcattcgttctagctacagctgacatggccggactgacg
agatacacgagatccaatatgcttgatgtattaaatcaagattatattcgcacagcgaga
gcaaaaggatttaaagagaacagagtgctatttaaacatggattgaggaatgcattatta
cccgtcattacaattttcggtttgatgattccttcatttatcggcggatctgtcgttgtc
gaacaaattttcacttggccgggattaggaaagctgtttgtcgattcagcattccagcgc
gattatccggttatcatggcaatgactgtgatctcggcggttcttgtcgttgtcggaaac
ctcattgcagacatcctttacgcgattgttgatccgcggatcgaatattaa

DBGET integrated database retrieval system