KEGG   Bacillus subtilis subsp. subtilis 168: BSU11400
Entry
BSU11400          CDS       T00010                                 

Gene name
appC
Definition
(RefSeq) oligopeptide transport system permease protein AppC
  KO
K02034  peptide/nickel transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11400 (appC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11400 (appC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BSU11400 (appC)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N DUF6132
Other DBs
NCBI-GeneID: 936394
NCBI-ProteinID: NP_389022
Pasteur: BG11089
BSORF: BG11089
UniProt: P42063 A0A6M4JGW2
Position
1216210..1217121
AA seq 303 aa
MSELQTTPSPEIRLKENISKKPETMTKIFWEKFSKNKLAILGAVILFIIIMSAVFAPLIA
PYPQEQQSLLDKYKAPGLEHLMGTDKFGRDIFSRILYGARVSLLVGFASVVGSILIGTVL
GALAGYFRGIVDAVIMRVVDIVLSIPDIFLLITLVTIFKPGVDKLILIFCLTGWTTTARL
VRGEFLSLRSREYVLAAKTIGTKTHKIIFSHILPNALGPIIVSATLKVGSVILAESALSY
LGFGIQPPIASWGNMLQDAQNFTVMIQAWWYPLFPGLFILMTVLCFNFVGDGLRDALDPK
NIK
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcagagctgcaaacaactccctcgccggagatcaggctgaaagaaaatatttcgaaa
aagccagaaacaatgacaaagattttctgggaaaaattctcgaaaaacaaactggccatt
ttaggtgccgttattctttttatcattattatgtctgctgttttcgcccctttaattgca
ccttatccccaagagcagcaaagcctgcttgataaatataaggcgccgggccttgaacat
ctgatgggaacggataaatttggacgtgatattttcagccggatcctatatggagcgcgt
gtctctttattggttggatttgcgtccgtagtcggttcgattttgatcggaacggtttta
ggagcattagccggatatttcagaggaatagtggatgctgtcattatgcgtgtagttgac
attgtgttatccattcctgatattttcttgttgatcacgctggtcaccatcttcaagccg
ggtgtggacaaattgattttaattttctgtctcacaggatggaccacaacagcacgatta
gtaaggggagaattcttgtcgctccgttcaagggaatatgttcttgctgctaaaacaatt
ggaacaaaaacgcacaaaattattttttctcatatcctgcccaatgcgttagggccgatt
atcgtgtcagctacgctgaaagttgggtctgttattctagctgaatcggcgctaagctac
ttgggctttggaatccagccgccaatcgctagctgggggaacatgcttcaagacgcacag
aatttcacagtaatgattcaagcatggtggtacccgttatttcccgggctatttatttta
atgaccgttttatgcttcaactttgtcggtgatggcctgcgggatgcgcttgacccgaaa
aatattaaataa

DBGET integrated database retrieval system