KEGG   Bacillus subtilis subsp. subtilis 168: BSU11410
Entry
BSU11410          CDS       T00010                                 

Gene name
yjbA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3603
Other DBs
NCBI-GeneID: 939369
NCBI-ProteinID: NP_389023
Pasteur: BG13130
BSORF: BG13130
UniProt: O31597 A0A6M4JIM7
Position
1217326..1218078
AA seq 250 aa
MLFLHDVWVNWFEGEENGYNVCHFHEWRKEDTVELLDQVPLLRVPSVLFHYIENDLSELP
KGLLEDVHQKSYIRKNHERTKLEYCFVVTDGIGILAVDTIGYTIPVRKSRLIPRQEQLVY
EMVKDVEPETYEFEPKKLESSKEYHILSLAPEHVRGLTRKERQIKQLMFMALDQLKGLKN
RAEIGYWYTEWNPHMYEQIKRMSFEEIWDMLYNETIEGWSDKHLAFCENLIKGQPFFEKL
WEMENESKVN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgttatttcttcatgatgtgtgggtcaattggtttgaaggggaagaaaatggctacaat
gtatgccactttcacgaatggcgcaaggaagatacggttgagcttttggatcaggtgccg
ctgttaagggtgccgtcagtactgtttcattacatagaaaacgatttgtcagagcttccg
aaaggtttgcttgaagacgtacatcagaaatcgtacattcgaaaaaatcatgagcggaca
aagcttgagtattgttttgtcgtaacagacggaatcggcattttagctgttgacacgatc
ggctacacgatccctgtcagaaaaagccgtctaatcccaagacaggagcagctcgtttat
gaaatggtaaaagatgtagagcctgaaacatatgaatttgagccaaagaagctggaatcc
tccaaggaatatcacatcttatcattagcaccagaacatgtcagaggactgacaagaaaa
gaacggcaaattaagcagctgatgtttatggcgcttgaccaattaaaagggctgaaaaac
cgagcggaaattggctactggtacacagagtggaatccgcatatgtatgaacaaatcaaa
aggatgagctttgaagagatttgggacatgctgtataacgaaacaattgaaggctggtcg
gacaaacacctagctttttgcgaaaacctaataaaaggacagccttttttcgaaaagctt
tgggaaatggaaaacgaatcaaaggtcaactga

DBGET integrated database retrieval system