KEGG   Bacillus subtilis subsp. subtilis 168: BSU11420
Entry
BSU11420          CDS       T00010                                 

Gene name
trpS
Definition
(RefSeq) tryptophan--tRNA ligase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU11420 (trpS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU11420 (trpS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU11420 (trpS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     BSU11420 (trpS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BSU11420 (trpS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU11420 (trpS)
 Prokaryotic type
    BSU11420 (trpS)
SSDB
Motif
Pfam: tRNA-synt_1b bMG3
Other DBs
NCBI-GeneID: 939361
NCBI-ProteinID: NP_389024
Pasteur: BG10799
BSORF: BG10799
UniProt: P21656 A0A6M3Z9S8
Structure
PDB: 
3PRH

Position
complement(1218113..1219105)
AA seq 330 aa
MKQTIFSGIQPSGSVTLGNYIGAMKQFVELQHDYNSYFCIVDQHAITVPQDRLELRKNIR
NLAALYLAVGLDPEKATLFIQSEVPAHAQAGWMMQCVAYIGELERMTQFKDKSKGNEAVV
SGLLTYPPLMAADILLYGTDLVPVGEDQKQHLELTRNLAERFNKKYNDIFTIPEVKIPKV
GARIMSLNDPLKKMSKSDPNQKAYITLLDEPKQLEKKIKSAVTDSEGIVKFDKENKPGVS
NLLTIYSILGNTTIEELEAKYEGKGYGEFKGDLAEVVVNALKPIQDRYYELIESEELDRI
LDEGAERANRTANKMLKKMENAMGLGRKRR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaaacaaacgattttttcaggcattcagccaagcggctcagtgacgctcggcaactat
atcggtgcaatgaagcagtttgtcgaactgcagcatgattataacagctatttttgcatc
gtcgatcagcatgcgataactgttcctcaagaccggcttgagcttagaaagaatatccgc
aatctcgcggcgctttacttagctgtcggacttgatccagaaaaagcaacattgtttatt
cagtcagaggtccccgcacatgcgcaggccggatggatgatgcagtgtgtcgcctatatc
ggcgagcttgagcggatgactcaatttaaggacaaatccaaaggcaatgaagctgtcgtc
tccggcctgttaacatatccgccgctgatggccgctgatattctgctgtacggaacggat
cttgtacctgtcggcgaggatcaaaagcagcaccttgagctgacgcggaatcttgcagaa
cgcttcaacaaaaaatacaacgacatctttacgattccggaagtgaaaattccaaaagtc
ggtgcacgtatcatgtctctgaatgatccgctgaagaaaatgagcaaatctgatccgaat
cagaaagcttatattacattgctggatgagccgaagcagcttgaaaagaaaatcaaaagc
gcagtaacggattctgaaggcattgtcaaatttgataaggaaaacaaaccgggcgtttcc
aaccttcttacaatttattcaatcctcggcaatacgacaattgaagagcttgaagcaaag
tacgaaggaaaaggctacggcgagtttaaaggtgatttggcagaagtcgtagtgaacgca
ttaaaaccgatccaggaccgctattacgagctgatagaatctgaagaattagaccggatt
cttgatgaaggcgcggaacgagcgaatcggacagcaaacaaaatgctgaaaaaaatggag
aatgccatgggtcttggaagaaaaagacgctaa

DBGET integrated database retrieval system