KEGG   Bacillus subtilis subsp. subtilis 168: BSU11430
Entry
BSU11430          CDS       T00010                                 

Symbol
oppA
Name
(RefSeq) oligopeptide ABC transporter binding lipoprotein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11430 (oppA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11430 (oppA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11430 (oppA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11430 (oppA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11430 (oppA)
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-GeneID: 936398
NCBI-ProteinID: NP_389025
Pasteur: BG10771
BSORF: BG10771
UniProt: P24141 A0A6M4JM05
Position
1219849..1221486
AA seq 545 aa
MKKRWSIVTLMLIFTLVLSACGFGGSGSNGEGKKDSKGKTTLNINIKTEPFSLHPGLAND
SVSGGVIRQTFEGLTRINADGEPEEGMASKIETSKDGKTYTFTIRDGVKWSNGDPVTAQD
FEYAWKWALDPNNESQYAYQLYYIKGAEAANTGKGSLDDVAVKAVNDKTLKVELNNPTPY
FTELTAFYTYMPINKKIAEKNKKWNTNAGDDYVSNGPFKMTAWKHSGSITLEKNDQYWDK
DKVKLKKIDMVMINNNNTELKKFQAGELDWAGMPLGQLPTESLPTLKKDGSLHVEPIAGV
YWYKFNTEAKPLDNVNIRKALTYSLDRQSIVKNVTQGEQIPAMAAVPPTMKGFEDNKEGY
FKDNDVKTAKEYLEKGLKEMGLSKASDLPKIKLSYNTDDAHAKIAQAVQEMWKKNLGVDV
ELDNSEWNVYIDKLHSQDYQIGRMGWLGDFNDPINFLELFRDKNGGNNDTGWENPEFKKL
LNQSQTETDKTKRAELLKKAEGIFIDEMPVAPIYFYTDTWVQDENLKGVIMPGTGEVYFR
NAYFK
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgaaaaaacgttggtcgattgtcacgttgatgctcattttcactctcgtgctgagcgcg
tgcggctttggcggcagcggatcaaacggtgaagggaaaaaggacagtaaaggaaagacg
acacttaacattaatattaaaactgagccgttctccttacatccgggattggcaaatgat
tcagtatcaggcggtgttatccgtcagacttttgaaggattgacacgtatcaatgcagat
ggtgagcctgaagaaggcatggcttctaaaattgaaacgagcaaggacggaaagacatat
acatttaccattcgtgatggtgtgaaatggtctaatggagaccctgtaactgcacaagat
tttgaatatgcttggaaatgggcgcttgaccctaataatgaatcacaatacgcttaccag
ctctactacataaaaggtgctgaagcggcgaataccggaaaaggcagcctagacgatgtg
gcagtaaaagctgtgaatgacaaaacgctgaaggttgaattaaataacccgactccatat
ttcactgaattaactgcgttctatacgtatatgccgatcaataagaaaattgcagagaaa
aataaaaagtggaatacaaatgccggagatgattatgtatcaaacgggccgttcaaaatg
acggcatggaaacacagcggctctattactctcgaaaaaaatgaccagtattgggataaa
gacaaagtcaaactgaagaaaatcgatatggttatgatcaacaataacaatacggaacta
aaaaaattccaagctggcgaacttgattgggccggtatgccgctcggacagcttccgaca
gaatccctgccgaccctgaaaaaagacggttctttacatgttgagccgattgcaggagtg
tattggtacaaattcaacactgaagctaagccattagacaacgtcaatatccgtaaagct
ttaacatattcgcttgaccgtcagtcgattgttaaaaacgttacgcaaggagagcaaatc
ccggcaatggctgcagtgccgcctacaatgaagggatttgaggataacaaagaaggatac
ttcaaagacaatgatgtcaaaacagcaaaagaataccttgaaaaaggcctaaaagaaatg
ggcttaagcaaggcatctgatttgccaaaaatcaaattgtcttacaacactgatgacgca
cacgcgaaaatcgctcaagcagtacaagaaatgtggaagaaaaatttaggcgttgatgtt
gagcttgataactcagagtggaatgtctatattgataagctccacagccaagattatcaa
atcggccgtatgggctggctcggcgacttcaatgatcctatcaacttccttgaattgttc
cgcgacaaaaacggaggaaataacgatacaggctgggaaaatccagaattcaaaaagctt
ctgaatcagtcacaaactgaaacagataaaacaaaacgtgcagagctgctgaaaaaagca
gaaggtattttcattgatgaaatgccggttgccccaatctatttctatactgatacttgg
gtacaggatgaaaacctaaaaggtgttatcatgccaggtactggtgaggtttatttcaga
aacgcatattttaaataa

DBGET integrated database retrieval system