KEGG   Bacillus subtilis subsp. subtilis 168: BSU11440
Entry
BSU11440          CDS       T00010                                 

Gene name
oppB
Definition
(RefSeq) oligopeptide transport system permease protein OppB
  KO
K15581  oligopeptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11440 (oppB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11440 (oppB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11440 (oppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11440 (oppB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11440 (oppB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N DUF2157
Other DBs
NCBI-GeneID: 936397
NCBI-ProteinID: NP_389026
Pasteur: BG10772
BSORF: BG10772
UniProt: P24138 A0A6M3ZA17
Position
1221594..1222529
AA seq 311 aa
MLKYIGRRLVYMIITLFVIVTVTFFLMQAAPGGPFSGEKKLPPEIEANLNAHYGLDKPLF
VQYVSYLKSVAMWDFGPSFKYKGQSVNDLISSGFPVSFTLGAEAILLALALGVLFGVIAA
LYHNKWQDYTVAILTIFGISVPSFIMAAVLQYVFSMKLGLFPVAGWDSWAYTFLPSIALA
SMPMAFIARLSRSSMIEVLNSDYIRTAKAKGLSRPAVTVRHAIRNALLPVVTYMGPMAAQ
VLTGSFIIETIFGIPGLGAHFVNSITNRDYTVIMGVTVFFSVILLLCVLIVDVLYGIIDP
RIKLSKAKKGA
NT seq 936 nt   +upstreamnt  +downstreamnt
ttgctaaaatatatcggaagacgcttagtctatatgattatcacactatttgtgattgta
actgtgacattcttcttaatgcaagcagcaccgggcgggccattttcaggtgagaaaaag
cttccgcctgaaattgaagcaaatttaaatgcgcattatggcttggacaagccgctgttt
gtacaatatgtcagttatttgaaatcagttgcaatgtgggatttcggaccgtcatttaaa
tataaaggtcagagtgttaacgacctgatcagttcaggtttccccgtttcatttactctt
ggagcagaagctattctcctcgctttagcgttaggtgtattgtttggggtcattgcagcc
ctttaccataataagtggcaggattataccgtcgcgattttaacgatatttggtatttcg
gttccgagctttatcatggcggctgttctgcaatatgtgttctccatgaagcttgggctg
tttccggtcgcggggtgggattcctgggcatacacctttttgccttccatcgcacttgct
tccatgccgatggcgtttattgccagactttcccgttcaagcatgatcgaagtgttaaac
agtgattatatccgcacagcgaaagcgaaagggctttcccgcccagcggttacagtgcgg
cacgccattcgaaacgcacttttgccggttgttacatatatgggcccgatggccgcacag
gtcttaacggggagcttcattattgaaaccatttttgggattccggggcttggtgcacac
ttcgtcaacagtattacaaaccgtgattatacggtcattatgggtgtaacggtgttcttc
agtgtcatcttgctattgtgtgtattaatcgtagatgtgttatacggcattattgatcca
agaatcaagctttccaaagcaaagaaaggagcctag

DBGET integrated database retrieval system