KEGG   Bacillus subtilis subsp. subtilis 168: BSU11450Help
Entry
BSU11450          CDS       T00010                                 

Gene name
oppC
Definition
(RefSeq) oligopeptide transport system permease protein OppC
  KO
K15582  oligopeptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11450 (oppC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11450 (oppC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11450 (oppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11450 (oppC)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11450 (oppC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF3176
Motif
Other DBs
NCBI-GeneID: 936396
NCBI-ProteinID: NP_389027
Pasteur: BG10773
BSORF: BG10773
UniProt: P24139
Position
1222533..1223450
Genome map
AA seq 305 aa AA seqDB search
MQNIPKNMFEPAAANAGDAEKISKKSLSLWKDAMLRFRSNKLAMVGLIIIVLIILMAIFA
PMFSRYDYSTTNLLNADKPPSKDHWFGTDDLGRDIFVRTWVGARISIFIGVAAAVLDLLI
GVIWGSISGFRGGRTDEIMMRIADILWAVPSLLMVILLMVVLPKGLFTIIIAMTITGWIN
MARIVRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVPNAMGSILVTMTLTVPTAIFTEA
FLSYLGLGVPAPLASWGTMASDGLPALTYYPWRLFFPAGFICITMFGFNVVGDGLRDALD
PKLRK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacattccaaaaaacatgtttgaaccagccgcagcgaatgccggcgatgcagaa
aaaataagtaaaaagagcctttccctctggaaagatgcgatgcttcgcttccgcagcaat
aagcttgcaatggtcgggcttatcattatcgtacttattatccttatggcaatttttgcg
ccgatgttctcaaggtatgattattcaactactaatctcttaaatgcggataagccgcct
tcaaaagatcactggttcggaacagatgatcttggacgggacattttcgtccgtacatgg
gtaggggcgcgaatctcaatctttatcggtgttgcagctgctgttctcgatttgctgatc
ggcgtcatttgggggagcatttcaggcttccgcggaggaagaacagatgaaatcatgatg
cgtatcgctgatatcctttgggcagttccttcattattaatggttatcttactgatggtt
gttcttccgaaaggtctatttacgattattattgccatgacgattacaggctggattaat
atggccagaatcgtgcgcggacaagtgctgcagctgaagaatcaggagtatgtgcttgct
tcacagacactgggtgcaaaaacatcccgtcttctatttaaacatatcgtgccaaacgca
atgggttctattttggtcacgatgacactgacagttcctactgcgatttttacagaagcc
tttttaagctatttgggacttggtgttccggctccgctggcaagctggggaacgatggct
tctgacggattgcctgcattgacctattatccgtggcgtttattcttccctgccggattt
atctgcattacaatgtttggttttaacgttgtcggcgacggattaagagacgcattggat
cctaagttacgtaaataa

DBGET integrated database retrieval system