KEGG   Bacillus subtilis subsp. subtilis 168: BSU11460
Entry
BSU11460          CDS       T00010                                 

Gene name
oppD
Definition
(RefSeq) oligopeptide transport ATP-binding protein OppD
  KO
K15583  oligopeptide transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11460 (oppD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11460 (oppD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11460 (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11460 (oppD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11460 (oppD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_29 TniB ATP-synt_ab AAA_16 DUF87
Other DBs
NCBI-GeneID: 939814
NCBI-ProteinID: NP_389028
Pasteur: BG10774
BSORF: BG10774
UniProt: P24136 A0A6M3Z9N1
Position
1223455..1224531
AA seq 358 aa
MIRVTRLLEVKDLAISFKTYGGEVQAIRGVNFHLDKGETLAIVGESGSGKSVTSQAIMKL
IPMPPGYFKRGEILFEGKDLVPLSEKEMQNVRGKEIGMIFQDPMTSLNPTMKVGKQITEV
LFKHEKISKEAAKKRAVELLELVGIPMPEKRVNQFPHEFSGGMRQRVVIAMALAANPKLL
IADEPTTALDVTIQAQILELMKDLQKKIDTSIIFITHDLGVVANVADRVAVMYAGQIVET
GTVDEIFYDPRHPYTWGLLASMPTLESSGEEELTAIPGTPPDLTNPPKGDAFALRSSYAM
KIDFEQEPPMFKVSDTHYVKSWLLHPDAPKVEPPEAVKAKMRKLANTFEKPVLVREVE
NT seq 1077 nt   +upstreamnt  +downstreamnt
gtgatacgggtgacacgcctattagaagtaaaagatttagcaatttcatttaaaacatat
ggcggagaggtccaggcgatccgcggagtgaatttccatctggataaaggggagacgctg
gccattgttggagaatcaggttccggaaaaagtgtaacctctcaagcgattatgaagctg
attccaatgcctccgggttatttcaaacgcggtgagatcctgtttgaaggaaaggatctg
gtgccgctgtccgaaaaagaaatgcaaaatgtccggggaaaagagatcggcatgatattc
caagatccgatgacctctttaaatccaacgatgaaggtcggtaaacaaattacggaagtg
ctttttaaacacgaaaagatctcgaaggaagcggctaaaaaacgcgcggttgaactgctg
gaattagtcggtatcccaatgccggaaaagcgggtgaaccaatttccgcatgaattttca
ggcgggatgagacagagggttgtcattgccatggcgcttgcagcgaatccgaaacttctg
atcgccgatgagccgacaactgctcttgatgtaacgattcaagcgcaaattttggaatta
atgaaggatttgcaaaagaaaattgacacgtccatcatctttatcacacacgatcttggt
gttgtggctaacgttgctgaccgggtcgctgtcatgtacgcgggacagattgtagaaact
ggtacggtagacgaaatcttctacgacccgagacatccgtacacttgggggcttcttgca
tccatgccgacactggaaagttcaggagaggaagagctgactgcaattccgggcacgccg
cctgatttgacaaacccgccaaaaggagatgcttttgccctgcggagctcttacgcgatg
aaaatcgattttgaacaggagccgccaatgtttaaggtatccgatactcattatgtaaaa
tcgtggctgcttcatcctgacgcgccaaaggtagagccgcctgaagcggtaaaagcgaaa
atgcgtaaactggcaaacacgtttgaaaaacctgtcttagtgagagaagttgaatga

DBGET integrated database retrieval system