KEGG   Bacillus subtilis subsp. subtilis 168: BSU11470
Entry
BSU11470          CDS       T00010                                 

Gene name
oppF
Definition
(RefSeq) oligopeptide transport ATP-binding protein OppF
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11470 (oppF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11470 (oppF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11470 (oppF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11470 (oppF)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11470 (oppF)
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 ATP-synt_ab G-alpha AIG1 AAA_13 AAA_21 AAA_16 AAA RsgA_GTPase
Other DBs
NCBI-GeneID: 936410
NCBI-ProteinID: NP_389029
Pasteur: BG10775
BSORF: BG10775
UniProt: P24137 A0A6M4JH02
Position
1224533..1225450
AA seq 305 aa
MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYE
ATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLA
KTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISA
LDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYE
NPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAE
FKAFS
NT seq 918 nt   +upstreamnt  +downstreamnt
ttgactgaaaaactattagaaatcaaacatttaaaacagcactttgtcacgccgagggga
acggttaaggctgtagatgatttatcatttgatatctataaaggtgaaacattagggctg
gttggtgaatctggctgcggtaaatcgacaacaggccgaagcattatcaggctgtacgaa
gcaaccgatggtgaggtgctgttcaacggcgaaaatgtgcacgggagaaaatcgcggaaa
aagctgctggaattcaaccgcaaaatgcagatgattttccaagacccctatgcatccctg
aatccgagaatgacagttgctgatattattgctgaaggccttgatattcataagctggca
aaaacgaaaaaagagcggatgcagcgagttcatgaactattggaaacagtgggattgaac
aaggaacacgcgaaccgctatcctcatgaattttccggcggccagcgccaaagaatcggg
attgccagagcgcttgctgttgatccggaattcattatcgcggatgagccgatttccgct
ttggatgtatccattcaagcgcaggtcgtgaatttaatgaaagaactgcaaaaagaaaaa
gggctcacatacctgtttattgcccacgatttatcgatggtcaaatacatcagtgaccgc
attggcgtcatgtatttcgggaaactggttgagcttgcgccggcagatgagctttatgaa
aatccgcttcacccatatacaaaatcattgctttctgcgattccgcttcctgatccggac
tatgagagaaatcgcgttcgccagaaatatgatccgtctgtccatcaattaaaggatggg
gaaacgatggaattccgtgaagtcaaaccgggacattttgtgatgtgcacggaagccgaa
tttaaagctttttcatga

DBGET integrated database retrieval system