KEGG   Bacillus subtilis subsp. subtilis 168: BSU11480
Entry
BSU11480          CDS       T00010                                 

Symbol
yjbB
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 936399
NCBI-ProteinID: NP_389030
Pasteur: BG13131
BSORF: BG13131
UniProt: O31600 A0A6M3ZI90
Position
1225557..1226774
AA seq 405 aa
MQFLHNKNVFALLLSQSFQSLAGVLVTIVLMVRIYQMTDSVFLAGLILSFMSFASIAASF
CVSPVLRILGFKKVLAGANLLRAVFIILMAYSVTHHGQAFFWITLLFVFCFSFAGAFFQP
ARFALLPIIVPKKQYVKANGVISLSNQLFLTAGWGLGGLLTYAVPFELVVGAAICLFVLS
GASISVLHVNEEEAAGTAETASVRSIWKDLMIIPIVRDITVMDMLEALAGSVWSSAILLA
FTAAVLHETEVWWGMFNASYFIGAIVGSVIAIRFSSFFERNMGYAIMFSSLVMSALTLLF
SFSPVPFLCALACAAMGPFYQVRDICQETMLQEVIPEQKRIGIMAAKNAILTPWSGVTYS
IMGLVADAAGAKIAFIAAAALYIMTFLIALAQPRLVHYRRENRVQ
NT seq 1218 nt   +upstreamnt  +downstreamnt
attcaatttctgcataacaaaaatgtttttgcgctattgctgtctcaatcttttcaatct
ttagcaggagtcctcgtcacaatcgttttaatggtccggatctatcaaatgactgactcc
gtttttttggcgggccttattttatcgttcatgtcgtttgcgagtatagcagcaagcttt
tgcgtctctccggtgcttcgcattctcggttttaaaaaggtgcttgcgggagcgaatctg
ctgagagcggtctttattatactgatggcatacagcgtcactcatcacggacaggcattc
ttttggattacgctgctgtttgtgttttgtttttccttcgcgggcgctttttttcagccg
gcaagatttgcgctgctgccgattattgttccaaagaagcaatatgtaaaagcgaatggt
gtgatctccctctcgaatcaattgttcttaacagcaggctggggccttggaggccttctg
acgtacgccgtcccttttgaactcgttgtcggcgctgccatttgcctgtttgttctatcg
ggagcttccatcagtgtgctgcatgtaaatgaagaagaggctgcaggaactgctgaaaca
gcatctgtcagaagtatatggaaggatttaatgatcatccctattgtaagagacattact
gtaatggacatgttagaagctttggcgggttccgtatggtcatctgctattctcctcgca
tttactgcggctgttttgcatgaaacagaggtgtggtgggggatgtttaacgcttcctat
tttataggcgcaattgtcggcagtgtgattgctattcgtttttcttctttttttgagcgg
aatatgggctatgccattatgttcagctcgcttgtaatgtcggcgctgacccttttgttt
tcattttctccagtcccatttttatgcgctctggcttgtgctgcaatggggcctttttat
caggtgcgtgatatttgccaggaaaccatgctgcaggaagttattcccgagcagaaacga
atcggaatcatggctgcaaaaaatgcgattttgactccttggtcaggcgtcacctactcc
attatggggctagtggctgatgctgctggtgcgaaaatagcttttatcgcggctgctgca
ttatatatcatgacatttctgattgcactggcgcagccccgtctggttcattacaggcga
gaaaatcgagttcaatga

DBGET integrated database retrieval system