KEGG   Bacillus subtilis subsp. subtilis 168: BSU11490
Entry
BSU11490          CDS       T00010                                 

Gene name
yjbC
Definition
(RefSeq) acetyltransferase YjbC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_7 Acetyltransf_10 Acetyltransf_1
Other DBs
NCBI-GeneID: 939373
NCBI-ProteinID: NP_389031
Pasteur: BG13132
BSORF: BG13132
UniProt: O31601 A0A6M4JHE1
Position
1226938..1227516
AA seq 192 aa
MNWYEKLSEYFPIEEMKSKAHMEALLKERSDIYHKDEGKHHILMFAEFDSFIFVDYLYVS
KDARGQGLGGKLIAKLKKKNKPILLEVEPVDEDDTDTEKRLRFYQREHFKHAQSIGYRRR
SLATNEVNKMEILYWSPKTESEEEILEAMKQTYENIHTYKDEKWYGESYEKTDEVLEIID
EEKQKNIFDQLS
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaactggtatgaaaagcttagcgagtactttccaattgaagaaatgaaatcaaaagcg
catatggaagctcttctgaaagagcgaagcgatatttatcataaagatgaaggcaaacat
catattttaatgtttgcggaattcgattcttttatcttcgttgattatctgtatgtgtct
aaggatgcaagagggcaggggcttggcggcaaattgatcgcgaagctgaaaaagaaaaat
aagcccatattgctcgaggtggaacctgtggatgaagatgatactgatacagaaaaacgc
ctgaggttttatcaaagagagcatttcaagcatgctcagtcaattgggtaccggcgccgg
tcattggctacgaatgaagtaaacaagatggagattctgtactggtcaccaaaaacagaa
tcagaagaagaaattcttgaagccatgaaacagacatatgaaaacattcatacttataaa
gatgagaaatggtacggagaatcgtacgaaaaaacggatgaggtcttggaaatcatcgat
gaagaaaaacaaaaaaatattttcgatcagttaagctaa

DBGET integrated database retrieval system