KEGG   Bacillus subtilis subsp. subtilis 168: BSU11500
Entry
BSU11500          CDS       T00010                                 

Symbol
spxA
Name
(RefSeq) regulatory protein spx
  KO
K16509  regulatory protein spx
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU11500 (spxA)
SSDB
Motif
Pfam: ArsC Glutaredoxin DUF1223 Glrx-like GST_N_3
Other DBs
NCBI-GeneID: 936407
NCBI-ProteinID: NP_389032
Pasteur: BG13133
BSORF: BG13133
UniProt: O31602 A0A6M4JHC4
Structure
Position
1227697..1228092
AA seq 131 aa
MVTLYTSPSCTSCRKARAWLEEHEIPFVERNIFSEPLSIDEIKQILRMTEDGTDEIISTR
SKVFQKLNVNVESMPLQDLYRLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRS
FQLREAQRLAN
NT seq 396 nt   +upstreamnt  +downstreamnt
atggttacactatacacatcaccaagctgtacttcatgcagaaaggcgagagcgtggctc
gaggagcacgagattccatttgtagaaagaaacattttctctgaacctttatcaattgat
gaaataaaacaaattcttcgaatgactgaggacggaacagatgaaatcatctcaacccgt
tcaaaagtattccaaaaactgaatgtgaacgttgaatctatgccgctgcaagatttgtac
cgcttgatcaacgagcatccaggtttgcttcgccgtccgatcatcattgacgaaaaacgt
ttgcaggtcggatataacgaagacgaaatcagacgtttcctgccaagaaaagttcgctct
ttccaattaagagaagcacagcgtttggcaaactaa

DBGET integrated database retrieval system