KEGG   Bacillus subtilis subsp. subtilis 168: BSU11510
Entry
BSU11510          CDS       T00010                                 

Gene name
yjbE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TerC LysE MarC
Other DBs
NCBI-GeneID: 939805
NCBI-ProteinID: NP_389033
Pasteur: BG13134
BSORF: BG13134
UniProt: O31603 A0A6M3Z9H1
Position
complement(1228135..1228791)
AA seq 218 aa
MEHDYLISLLVIVGIDLILGGDNAVVIAMASRHLPDKQRQQAIILGTFIAVAMRIGLTSA
AVYLLNIPFLQCAGGIFLLYLGYQLLIEKKDTKHIKSSTSLWRAIRTIVLADLFMSLDNV
IAVAGASHGEFSLVVIGLCVSVPVIIWGSKLIHIALEKIPLLIYAGSGLLAYTGGEMIVR
DKKLSLFMAQHGTVETLLPILTVAFVILASIYYQQVEK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggagcatgactatctgatttctctgctcgtcattgttgggattgacctgatcctcggc
ggagataacgcggttgttattgccatggccagcagacatttgccggacaagcaaagacag
caagccattattctcggaacatttattgccgttgccatgagaatcggattaacaagtgca
gcagtatatcttttgaacattccgttcttgcagtgcgccggcggaattttcctgctgtat
ttaggatatcagctgctgattgaaaaaaaagacacgaaacacattaaaagcagcacctcc
ctgtggagagcgatacgaacgattgtgcttgcagatctctttatgtcgctggacaacgtc
atcgcagttgcgggagcttcacacggtgagttttctctcgttgttataggattgtgtgta
tcggttccggttattatttggggcagcaaactcatccatattgcactagagaaaataccg
cttctgatttacgcgggaagcgggctgcttgcttatactggcggagaaatgattgtcaga
gacaaaaagctgtcgctttttatggcgcagcacggcacagtcgaaacgctcctccccatt
ttgacggttgcgtttgtcatccttgcgagcatttattaccagcaggttgaaaaataa

DBGET integrated database retrieval system