KEGG   Bacillus subtilis subsp. subtilis 168: BSU11520Help
Entry
BSU11520          CDS       T00010                                 

Gene name
mecA
Definition
(RefSeq) adaptor protein MecA
  KO
K16511  adapter protein MecA 1/2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU11520 (mecA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MecA
Motif
Other DBs
NCBI-GeneID: 936406
NCBI-ProteinID: NP_389034
Pasteur: BG10680
BSORF: BG10680
UniProt: P37958
Structure
PDB: 

Position
1229068..1229724
Genome map
AA seq 218 aa AA seqDB search
MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPL
WIQVQALDKGLEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQ
EEKEQKLQFVLRFGDFEDVISLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLS
ILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaagaattaacgagcatacagtaaaattttatatgtcttacggagatatt
gaagatcgcggttttgacagagaagaaatttggtataaccgtgagcgcagtgaagaactt
ttctgggaagtcatggatgaagttcatgaagaagaggaattcgctgtggaaggcccactt
tggattcaagttcaggcactggacaaaggattagaaatcatcgtcacaaaagcccagctt
tccaaagacggacaaaagctcgaactgccgattcctgaggataaaaagcaagaaccagca
tctgaggatcttgacgccttgctggatgatttccagaaagaagagcaagccgtcaatcag
gaagagaaggagcaaaagcttcaatttgtcttgcgatttggcgattttgaggatgttatt
tctctatctaaattgaacgttaacggaagcaaaacgactttatattcgtttgagaaccga
tattatttatatgtagatttttgcaatatgactgatgaagaggttgaaaatcagctaagc
atcctgctggagtacgcaactgaatcctcaatcagcatacaccgtcttgaagagtacggc
aagctgattatttcagagcatgctctagaaacgataaaaaaacactttgcatcatag

DBGET integrated database retrieval system