KEGG   Bacillus subtilis subsp. subtilis 168: BSU11530
Entry
BSU11530          CDS       T00010                                 

Symbol
coiA
Name
(RefSeq) competence protein CoiA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CoiA
Other DBs
NCBI-GeneID: 939370
NCBI-ProteinID: NP_389035
Pasteur: BG13135
BSORF: BG13135
UniProt: O31604
Position
1229915..1231036
AA seq 373 aa
MFHLLGAQQNQKLKRRRFFCPVCGGELAVKLGLQKAPHFAHKQNKSCAIDIEPESAYHLE
GKRQLYVWLKTQRASPILEPYIRTINQRPDVMARIKEHMLAVEYQCATIAPDVFQKRTEG
FKQEGIIPQWIMGYSRLKRTASSFYQLSTFHWQFINASPYRELICYCPERRSFLRLSHII
PFYTNHSYSSVQTIPIHRAGAGDLFFTEPKPSIQYSGWTKAIHRFRHKPHRFNSKETNRL
RLLFYEKRQTPFSFLPTEVFVPVRKGAVFKSPVFVWQGFLYLFMTDLGGKRAPIRFSAVL
QQCKLHIHNKNIALRSECSEECLSEAVKQYIDFLCKKGFLRETQKEVYVLNQPAGGIHSM
QDLIERDRSCFIE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtttcaccttctaggcgctcagcaaaaccagaaattaaagcggagacggttcttctgt
ccggtatgcgggggagagctagctgtgaagctcggacttcaaaaagcgccgcattttgcc
cataaacagaacaagtcctgcgccatagacatcgagccggaaagcgcctaccacttagaa
ggaaaaagacagctgtatgtatggctgaaaacgcaacgggcttcaccaatattggagccg
tatataaggacaatcaaccaaagaccggacgtcatggcaagaatcaaggagcatatgctt
gctgttgaatatcaatgcgccactatcgctccagatgtctttcaaaagcggacagagggc
ttcaaacaagaaggaatcatcccgcagtggattatgggatacagccgcttaaaacggact
gcttcgtccttttatcagctttcaacttttcattggcagtttatcaatgcaagtccatac
agagaactgatatgttattgtcctgaaaggcgttcttttctccggctcagccacatcatt
ccattctacacaaaccattcttattcctcagtccaaacgatccctatccatcgggcaggt
gcaggcgatctttttttcactgaaccgaaaccctcaattcaatattcaggctggacgaaa
gcgattcaccgttttcgccataaaccccatcggtttaactcaaaggaaacaaatcgcctt
aggctgctgttttatgagaaacgacagacgcctttttcttttctgccgactgaagtgttt
gttcctgttagaaaaggggcagtttttaagagtccggtttttgtgtggcaggggtttctt
tatttgtttatgacggatcttggaggtaaacgtgcgccaattcgtttttcagccgttttg
cagcagtgcaaactgcacattcataataagaacattgcactcaggtccgaatgcagcgaa
gagtgtctttcagaagcggttaaacagtatattgattttttgtgcaagaagggattttta
agggagactcagaaagaagtatatgtgctgaatcagcctgcaggaggcatacactccatg
caggatctcatagaaagagaccgcagctgttttatagaatga

DBGET integrated database retrieval system