KEGG   Bacillus subtilis subsp. subtilis 168: BSU11549
Entry
BSU11549          CDS       T00010                                 

Symbol
yizD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303008
NCBI-ProteinID: YP_003097703
UniProt: C0H3Y6 A0A6M3Z9P1
Position
complement(1233133..1233300)
AA seq 55 aa
MMSTLISIVCIAVFFCLNILGMMHMLPLYITSPLLFLSILFTLYRLNHRKTFKGF
NT seq 168 nt   +upstreamnt  +downstreamnt
atgatgtctactttgatctcaattgtgtgcattgctgtttttttctgcttgaatatctta
ggcatgatgcatatgctgccgctttatattacctctcctctgctgtttctgtctattttg
tttaccctctaccgcttgaatcaccggaaaacctttaaagggttttaa

DBGET integrated database retrieval system