KEGG   Bacillus subtilis subsp. subtilis 168: BSU11550
Entry
BSU11550          CDS       T00010                                 

Gene name
yjbH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Thioredoxin_5 DSBA Thioredoxin_4 Thioredoxin_2
Other DBs
NCBI-GeneID: 939365
NCBI-ProteinID: NP_389037
Pasteur: BG13137
BSORF: BG13137
UniProt: O31606 A0A6M3Z9F1
Position
complement(1233614..1234513)
AA seq 299 aa
MTNYQHELYFAHCHGHPKKPLEIYMFVDPLCPECWSLEPVIKKLKIRYGRFFTLRIIASA
SLTALNKKRKKHLLAEAWEKIASRSGMSCDGNVWFEQDQPLSSPYMAALAFKAAELQGRK
AGMQFLRNMQESLFVSKKNITDENVLLEIAENTSLDLEEFKKDLHSQSAVKALQCDMKIA
AEMDVSVNPTLTFFNTQHEDEGLKVPGSYSYDVYEEILFEMLGDEPKPSETPPLECFIEY
FRFVASKEIALVYDLSLEEVEKEMKKLAFAKKVAKVEAKHGMFWKSLSTYSDEYQSCEK
NT seq 900 nt   +upstreamnt  +downstreamnt
ttgacaaactatcagcatgagctatacttcgcccattgccacggtcatccaaaaaaaccg
cttgaaatttatatgtttgtagaccctttatgtcctgaatgctggtccttagagcccgtc
atcaaaaagctgaaaatcagatacggacgttttttcaccttacgcattatcgcttccgca
agccttaccgctttaaataaaaagcgaaaaaagcatcttctcgcagaagcatgggaaaag
atcgcgagccgctctggcatgtcatgtgacggcaatgtctggttcgaacaggatcagccg
ctttcatcgccttatatggctgctctcgcttttaaagcagccgaactgcaaggacgaaaa
gccggcatgcaatttctcagaaatatgcaggagagcctatttgtttcaaagaaaaatatt
acggatgaaaacgtgcttttggagattgctgaaaatacaagtctcgatcttgaagaattc
aaaaaagatctgcattctcaaagcgcggtcaaggcgcttcaatgtgacatgaaaattgct
gccgagatggatgtttctgttaatccgacactgacgttttttaatacgcagcatgaggat
gaagggcttaaagttcctggcagctactcatatgatgtatatgaagaaattttatttgag
atgcttggcgacgagccgaagccgtcggaaacaccgcctttagaatgttttattgaatat
ttccgcttcgttgcctcgaaggaaattgctcttgtatatgacctgagccttgaagaggta
gaaaaagaaatgaaaaaactggcgtttgctaaaaaggttgccaaagtggaagccaaacac
ggaatgttttggaagtctctcagcacttattctgatgaatatcaatcatgtgaaaaatag

DBGET integrated database retrieval system