KEGG   Bacillus subtilis subsp. subtilis 168: BSU11560
Entry
BSU11560          CDS       T00010                                 

Gene name
yjbI
Definition
(RefSeq) group 2 truncated hemoglobin YjbI
  KO
K06886  hemoglobin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU11560 (yjbI)
SSDB
Motif
Pfam: Bac_globin Protoglobin
Other DBs
NCBI-GeneID: 936416
NCBI-ProteinID: NP_389038
Pasteur: BG13138
BSORF: BG13138
UniProt: O31607 A0A6M4JHF0 A0A063XGS7
Structure
PDB: 
1UX8

Position
complement(1234510..1234908)
AA seq 132 aa
MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGP
PLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARH
MVNQTEAEDRSS
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggacaatcgtttaacgcaccttatgaagcgattggagaggaacttctatcgcaactt
gttgatactttttatgagcgtgtcgcgtctcatcctttgctgaagccgatttttccaagc
gatttgacagaaaccgccaggaaacagaagcaattcttaactcagtatttaggcgggcct
cctctttatactgaggaacacggccatcctatgctcagagcaaggcatcttccctttcca
attacaaacgagagagctgatgcgtggctcagctgtatgaaggacgcaatggaccatgta
gggctggagggcgaaattcgtgagtttttgtttggccggctggagttgacagcaaggcat
atggtgaatcaaacggaagcggaggatcgatcatcttga

DBGET integrated database retrieval system