KEGG   Bacillus subtilis subsp. subtilis 168: BSU11570
Entry
BSU11570          CDS       T00010                                 

Gene name
yjbJ
Definition
(RefSeq) murein lytic transglycosylase YjbJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SLT SLT_2 SLT_4 Transglycosylas
Other DBs
NCBI-GeneID: 939382
NCBI-ProteinID: NP_389039
Pasteur: BG13139
BSORF: BG13139
UniProt: O31608 A0A6M3ZIK5 A0A0A1HAW6
Position
complement(1235163..1235708)
AA seq 181 aa
MLNSANTTAPSLLSAYGLNSYTSSNSGSVTKAAESTETAVADSASNKHEANQIRSGDFSI
DSAIKKAADKYGVDEKLIRAVIKQESGFNAKAVSGAGAMGLMQLMPSTASSLGVSNPLDP
QQNVEGGTKYLKQMLDKYDGNVSMALAAYNAGPGNVDRYGGIPPFQETQNYVKKITSVYY
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atgctgaacagcgcgaatacaacagcgccgtcactgctttcagcgtatgggcttaactca
tatacgagcagcaattcaggttcagtcacaaaagcggcagaaagcactgaaacagctgtt
gcagattcagcttcaaacaaacatgaagcaaatcagatccgttcgggagacttctctatt
gacagtgcgattaaaaaagccgctgataaatatggcgttgatgaaaaactgatccgcgcc
gtcatcaaacaggaatcaggctttaatgcaaaagcggtcagcggagcaggtgcgatgggc
ctcatgcagctgatgccgtcaacagcaagctcacttggcgtttccaatccgcttgatccg
cagcaaaatgtggagggcggaacgaaatatttaaaacaaatgctggataaatacgacggc
aatgtgtctatggcattagcggcttacaacgccggaccggggaatgttgaccgatacgga
ggcattcctcctttccaagaaacgcaaaactatgtaaaaaaaataacttcagtttattac
gcgtaa

DBGET integrated database retrieval system