KEGG   Bacillus subtilis subsp. subtilis 168: BSU11580
Entry
BSU11580          CDS       T00010                                 

Symbol
yjbK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CYTH
Other DBs
NCBI-GeneID: 936408
NCBI-ProteinID: NP_389040
Pasteur: BG13140
BSORF: BG13140
UniProt: O31609 A0A6M3Z9G0 A0A085CAB1
Position
complement(1235912..1236484)
AA seq 190 aa
MSQEIEIEFKNMLTKQEFKNIASALQLTEKDFTDQKNHYFDTDSFALKQKHAALRIRRKN
GKYVLTLKEPADVGLLETHQQLSEVSDLAGFSVPEGPVKDQLHKLQIDTDAIQYFGSLAT
NRAEKETEKGLIVLDHSRYLNKEDYEIEFEAADWHEGRQAFEKLLQQFSIPQRETKNKIL
RFYEEKRKSI
NT seq 573 nt   +upstreamnt  +downstreamnt
atgagccaagagattgaaatcgaatttaaaaacatgctgaccaaacaagaattcaaaaac
atagcatcggcactccagctgacagaaaaagattttacagatcaaaagaatcattatttt
gatacagacagcttcgcgctgaaacaaaaacatgctgcgcttcgtatccgcagaaaaaac
ggaaagtatgtccttacattaaaggagccggctgatgtggggcttctggaaacgcaccag
cagctttcagaggtatcagatctcgctggattttcagttcccgagggccctgtgaaggac
cagctgcacaagcttcagatcgatacggatgccatacaatactttggatctttagcaaca
aaccgtgcggaaaaagaaacagaaaaaggcttaatagttttagaccacagccgatattta
aataaagaggactatgaaattgaatttgaggcggcggattggcatgagggcagacaagcc
ttcgaaaagctgcttcagcaattcagcattcctcagcgcgaaaccaaaaataaaattctg
cgtttttatgaagaaaaacgaaagtctatataa

DBGET integrated database retrieval system