KEGG   Bacillus subtilis subsp. subtilis 168: BSU11590
Entry
BSU11590          CDS       T00010                                 

Gene name
yjbL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0738
Other DBs
NCBI-GeneID: 939376
NCBI-ProteinID: NP_389041
Pasteur: BG13141
BSORF: BG13141
UniProt: O31610 A0A6M3Z9I0 A0A063XBU5
Position
1236609..1236977
AA seq 122 aa
MQNRIEILNATLSDDQLRLACQTEGNEAERKPSGQMLVDSDHFAFVYILELADSFEYVII
KEHVWPELKQAHAQKIPVVLEAGDQTIELAGLHEELEYLLENIKDNANYGEEMEEKVKRV
FL
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcaaaacagaatcgaaattttgaatgcaacattatcggatgatcagcttcgccttgcc
tgtcagacagaaggaaacgaagcggaacgcaagccgtcaggtcaaatgcttgttgattct
gaccactttgcttttgtatacatacttgaattagctgattcttttgaatatgtcattata
aaggaacatgtatggccggaactgaagcaggcccatgcacaaaaaataccggttgtttta
gaggcaggagaccaaacaattgaactggcaggcctgcatgaggagctggaatatctttta
gaaaatataaaagataatgcaaactatggagaagaaatggaagaaaaagtgaaacgcgtg
tttttatag

DBGET integrated database retrieval system