KEGG   Bacillus subtilis subsp. subtilis 168: BSU11600
Entry
BSU11600          CDS       T00010                                 

Gene name
yjbM
Definition
(RefSeq) GTP pyrophosphokinase YjbM
  KO
K07816  putative GTP pyrophosphokinase [EC:2.7.6.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU11600 (yjbM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     BSU11600 (yjbM)
SSDB
Motif
Pfam: RelA_SpoT Trimer_CC Surfac_D-trimer RNA_pol_Rbc25
Other DBs
NCBI-GeneID: 939809
NCBI-ProteinID: NP_389042
Pasteur: BG13142
BSORF: BG13142
UniProt: O31611 A0A6M4JIP3 A0A063XH60
Structure
PDB: 
5DEC 5F2V 5DED

Position
1237006..1237641
AA seq 211 aa
MDDKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRK
SIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYH
LVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAA
SRLDEEMSEIRGEVQEAQAAFSRKKKGSEQQ
NT seq 636 nt   +upstreamnt  +downstreamnt
atggatgacaaacaatgggagcgttttttagtgccgtaccgccaggctgtcgaagagttg
aaagtgaagctcaaggggatccgcacactatatgaatacgaggacgaccattcaccgatc
gaatttgtgaccggacgcgtcaagcctgtggcgagcatacttgaaaaagcgagacggaaa
agcataccgctgcatgaaattgaaaccatgcaggacattgctggccttagaatcatgtgc
caatttgtcgatgacatccaaatcgtaaaagagatgctttttgccagaaaagatttcacc
gttgtggatcagagggattatattgcggaacataaagagagcggataccgatcataccat
cttgttgtgctgtaccctttgcagacggtatccggagaaaagcatgttctcgtagaaata
cagatccgtacactggcgatgaatttttgggcgaccattgaacattcattgaattataaa
tacagcggaaacattcctgaaaaagtaaaactaaggcttcagcgcgcttctgaagcggct
tcccggcttgatgaagagatgtcggagatcaggggtgaagtacaggaagctcaagctgcc
ttttcaagaaagaaaaaaggaagcgagcaacaatag

DBGET integrated database retrieval system