KEGG   Bacillus subtilis subsp. subtilis 168: BSU11610
Entry
BSU11610          CDS       T00010                                 

Gene name
ppnK
Definition
(RefSeq) inorganic polyphosphate/ATP-NAD kinase 1
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU11610 (ppnK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     BSU11610 (ppnK)
SSDB
Motif
Pfam: NAD_kinase_C NAD_kinase
Other DBs
NCBI-GeneID: 936414
NCBI-ProteinID: NP_389043
Pasteur: BG13143
BSORF: BG13143
UniProt: O31612 A0A6M4JFA3 A0A063XGS3
Position
1237660..1238460
AA seq 266 aa
MKFAVSSKGDQVSDTLKSKIQAYLLDFDMELDENEPEIVISVGGDGTLLYAFHRYSDRLD
KTAFVGVHTGHLGFYADWVPHEIEKLVLAIAKTPYHTVEYPLLEVIVTYHENEREERYLA
LNECTIKSIEGSLVADVEIKGQLFETFRGDGLCLSTPSGSTAYNKALGGAIIHPSIRAIQ
LAEMASINNRVFRTVGSPLLLPSHHDCMIKPRNEVDFQVTIDHLTLLHKDVKSIRCQVAS
EKVRFARFRPFPFWKRVQDSFIGKGE
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaaatttgccgtatcatcaaaaggagatcaagtttctgatacgctgaaaagcaaaata
caggcgtatttattggattttgatatggaactggatgaaaatgaaccggaaatcgttatt
tcagtcggaggcgacggaacgcttttgtatgcttttcacagatacagcgaccgtttggac
aaaacagcatttgtcggcgttcacacaggtcatctgggtttttatgccgactgggttcct
catgaaattgaaaaacttgttcttgccatcgcgaaaacgccgtatcatacagtcgaatat
ccgcttctcgaagtcattgtgacctatcacgaaaacgagcgggaagaaagatacttagct
ttgaatgaatgtacgattaaaagcatcgaaggaagccttgttgctgatgtggaaatcaaa
gggcagctctttgaaaccttccggggcgacggcctctgcctgtcaactccatcaggcagc
acagcctacaataaggcgctgggcggagcgattatccatccgtctatcagggcgatccag
cttgcggaaatggcttcaattaataaccgcgtgttccgtacggtcgggtcacctctgctt
ctcccatcccatcatgattgcatgattaagccgagaaacgaagttgactttcaagtgacg
attgaccatttaacccttctccataaggatgtaaagtcgatccgctgccaagttgcatcc
gaaaaagtgcggtttgcgagattccgtccgtttccattttggaaaagagtccaggattcg
tttattggaaaaggtgaatag

DBGET integrated database retrieval system