KEGG   Bacillus subtilis subsp. subtilis 168: BSU11620Help
Entry
BSU11620          CDS       T00010                                 

Gene name
yjbO
Definition
(RefSeq) RNA pseudouridine synthase YjbO
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU11620 (yjbO)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BSU11620 (yjbO)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    BSU11620 (yjbO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 939808
NCBI-ProteinID: NP_389044
Pasteur: BG13144
BSORF: BG13144
UniProt: O31613 A0A0A1HAW7
Position
1238523..1239374
Genome map
AA seq 283 aa AA seqDB search
MTVKEYAGELGISKRLLTDIKFGGGDLQINGEHVTVKYVLKEGDLLIVKFPEEQVSETLL
AEPVPLDILYEDEHVLVINKQPYVSSIPSREHPSGSIANGIIDHYQTTGVRATVHLVTRL
DRDTSGIMLVAKHRFAHSILSSAQKNGLVKRRYAAVVHGRMAQMEGTVDAPIGRHPDSII
ERTVTPDGQKAVTHFYVTCANDDMTSVALQLETGRTHQIRVHMSYLGHPLCGDTLYGGTR
QEIGRQALHSEHLSFIHPLTQENMRFHAPLPQDMSKLIKGENH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaaagaatatgccggtgaactgggaatttcgaaacgtctgctgaccgatatt
aagtttggcgggggagacctgcagattaacggtgagcatgtgacggtcaaatacgttttg
aaagagggagatcttcttatcgtgaagtttcctgaggagcaggtgagcgagacgctgttg
gcagagcctgttccgctcgatatcctttatgaggatgaacatgtgcttgtgataaacaag
cagccgtatgtgtcatcaatcccttcgagagagcacccctccggcagcattgccaatgga
attattgatcattatcaaacaaccggagtgagggcgacagttcatcttgtcacccggtta
gaccgggatacatcaggtatcatgcttgttgccaagcatcgatttgcccactccatttta
tcgtctgcgcaaaaaaacggccttgtgaaacgccggtatgcggcagtggttcacgggcgg
atggcacagatggagggaacagtcgatgctccgattggcagacatcctgacagtattatt
gaacggacggtaacgccagacggccagaaggctgttactcatttttacgtcacatgtgca
aatgatgacatgacctcggtggcattgcagcttgagactggacgaacccatcaaattcgt
gttcatatgagctatctcgggcacccgttgtgcggcgatacactgtacggcggaacgaga
caggaaattggccggcaggctctgcacagcgagcatctttcgtttatccatccgctgaca
caggagaacatgaggtttcatgctccactgcctcaggacatgagcaaactgataaaagga
gagaatcattga

DBGET integrated database retrieval system