KEGG   Bacillus subtilis subsp. subtilis 168: BSU11630
Entry
BSU11630          CDS       T00010                                 

Gene name
yjbP
Definition
(RefSeq) Bis(5'-nucleosyl)-tetraphosphatase PrpE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 936412
NCBI-ProteinID: NP_389045
Pasteur: BG13145
BSORF: BG13145
UniProt: O31614 A0A6M3Z9U8 A0A0A1MBE3
Position
complement(1239387..1240121)
AA seq 244 aa
MAYDIISDIHGCYDEMTALIQKLGYTIKNGVPVHEEGRVLVFAGDLTDRGPKSIEVIRFV
AGAYEKGAVRYVPGNHCNKLYRYLKGNPVKVMHGLETTAAELEELSKDEKKSVSEQFMKL
YETAPLYDILHNGELVVAHAGIRADDIGKYTRRVKDFVLYGDVTGETYPDGRPIRRDWAA
AYNGKAWVVYGHTPVKEPRKVNRTINIDTGCVFGNQLTGFRFPEIETVSVPSSLPYDESR
FRPI
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcttacgatatcatcagcgatattcatggctgctatgacgaaatgactgcattaatc
caaaagcttggctatacaatcaaaaatggagtacctgtccatgaagaaggcagggtgctt
gtttttgccggagatttaactgacagagggcccaaatcgatagaggtcatccgatttgta
gccggcgcttacgaaaaaggcgctgtgcgttatgtcccgggaaaccattgcaataaatta
tatcgttacttaaaaggaaatccggtaaaagtgatgcatggtctcgaaacaacagcggca
gagcttgaggaactttccaaagatgagaaaaaatcagtcagcgaacagtttatgaagctg
tacgaaacagcgccgctttacgacatcttacataatggagaattagttgtcgcccatgct
ggcataagagctgacgatatcggcaaatatacccgcagagtgaaggactttgtgctttac
ggtgacgtgacgggtgaaacatatccggacggcagacccatcaggcgtgattgggcggca
gcctataacggaaaggcttgggtggtatacggtcatacacctgtgaaagagcctcggaag
gtcaatcgcaccatcaacattgatacaggctgcgtgttcggaaatcaactgacaggcttt
cgctttccagaaatagaaaccgtctctgttccaagctccctgccttacgacgaatcaaga
tttcgccccatataa

DBGET integrated database retrieval system