KEGG   Bacillus subtilis subsp. subtilis 168: BSU11640
Entry
BSU11640          CDS       T00010                                 

Gene name
yjbQ
Definition
(RefSeq) Na(+)/H(+) antiporter YjbQ
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU11640 (yjbQ)
SSDB
Motif
Pfam: Na_H_Exchanger TrkA_C TrkA_N DUF166 NAD_binding_2
Other DBs
NCBI-GeneID: 939371
NCBI-ProteinID: NP_389046
Pasteur: BG13146
BSORF: BG13146
UniProt: O31615 A0A6M4JEY4 A0A085CAB7
Position
1240356..1242200
AA seq 614 aa
MAHTSVASLVVVLIVAFLTPILLHRFKLSIPVVVAEIIMGLIIGKSGLNLVVEGDTWLQT
LSMLGFIFLMFLSGLEIDFSSFEKGKKKQFLPNGKEAPNTFAAASVIFVGIFILSLLLSY
GFVLAGFIQNAFLMTLIISTISLGVVVPTLKEERIMNSNIGQIILLVAVIADLATMILLA
VFSSLYGEDSGNMWLLMILFAAGVVLYFFGRVFKHRSFVQSMSKGTIQIGTRAIFTLIIV
LVALSESLGAENILGAFLAGVLVSLLSPNKELVQQLDSFGYGFLIPIFFVMVGVKLDIWT
LFQDKTILIMIPLLLLALLVSKIIPVMYLKKWYDNRTIFASGFLLTSTLSLVIAAATIGQ
QLHVISTNMSGALILVAVIASIFTPICFKKLYKREEQPEEKKTITFIGANQMTLPVTLEL
PEEEYDVRVVHVYQENAEEKLSESVFAVETISDYEHETLESLGIFETDILVVATGNEDMN
ADIALLAKDKGTERVIASVGSPEHEAALKEQGISIFSILLSTKTLLRALIEAPGVMKLLT
NQESSLYQINMENSKYDGVILREFPLTGDVIFVRIFRGVDSIVPHGDTRLKLGDRLIVTG
SRGYVTDLKKTLEG
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggcgcatacatctgtcgcatctttagttgttgtacttatcgttgcatttttgacaccc
atccttttgcatcggtttaaactcagcatcccggttgttgttgctgaaatcattatgggg
ctgataattgggaaaagcggccttaatttagttgtggagggtgacacctggctccagaca
ctctctatgctcggatttatctttttaatgtttttaagcgggcttgaaattgatttttcg
tcgtttgagaaaggaaagaaaaagcagttcctgccgaatggcaaggaagcgccgaatacg
tttgctgcggcatctgttattttcgtcggtatttttattttatcattgctcttgtcctat
gggttcgtcttggccggatttatccaaaatgcatttttgatgaccctgattatttcaacg
atttcattaggcgttgtcgttccaacattaaaagaagaacggatcatgaattcgaatatc
gggcagattattttgcttgttgctgttattgctgatttggccacgatgattcttcttgct
gttttttcttctttatacggagaggacagcggaaacatgtggctcctgatgattctgttt
gcggccggagtggtgctttactttttcggccgggtcttcaaacatcgctcttttgttcaa
tccatgtcaaaagggacgatccagatcgggacgcgtgccatttttacgttaatcattgta
ctcgttgccctgtctgaatcacttggggcggaaaatattctcggcgctttcttagcgggg
gttcttgtttccctgctttcgccaaacaaagaacttgttcagcagctggactcattcggt
tatgggttcttaataccgattttcttcgtgatggtcggtgtgaagcttgatatttggact
cttttccaggataaaacaattttaatcatgattccgctcctgctgcttgcgctgttagtc
agcaaaatcattcctgtcatgtacttaaagaagtggtatgataaccgaaccattttcgcg
tctggtttcctgctgacatcaacgctttcgctcgtgattgctgctgcaacaatcggccag
cagcttcacgtgatcagtacaaatatgtcaggagcgctaattttagtagccgtcattgca
agtatttttacgccgatctgttttaaaaaattatacaaacgggaagagcagccggaggag
aaaaagacgattacgttcattggcgccaatcaaatgactttgcctgtcacactcgaattg
ccagaggaagagtatgacgtgcgtgttgtacacgtctaccaagagaatgcggaggaaaag
ctgtcagaatcagtgtttgctgttgaaacaatttctgactatgaacacgagacgcttgaa
tcactcggcatttttgaaacggatatcctcgttgtggcgacaggaaatgaagatatgaat
gcagacattgcattacttgcaaaagataaaggcacagaaagagtcattgcaagcgtagga
tcaccggagcatgaagcagctctgaaggagcagggaatcagcatcttttctattctgctg
tcgacaaaaacgctgcttcgcgcactgattgaagcgcctggcgtcatgaagctgctcacg
aaccaagagtcttcgctgtatcaaattaatatggagaacagtaaatatgatggtgtcatt
ttacgggaattccctttaacaggtgacgtcatctttgtcaggatcttcagaggtgtggac
agcatcgttcctcatggggatacgaggctgaaacttggagaccgtttaattgtcaccgga
tctcgggggtacgtaacggatcttaagaaaacattggaaggataa

DBGET integrated database retrieval system