KEGG   Bacillus subtilis subsp. subtilis 168: BSU11650
Entry
BSU11650          CDS       T00010                                 

Gene name
tenA
Definition
(RefSeq) thiaminase
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU11650 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU11650 (tenA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BSU11650 (tenA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU11650 (tenA)
SSDB
Motif
Pfam: TENA_THI-4 TPR_MLP1_2
Other DBs
NCBI-GeneID: 939807
NCBI-ProteinID: NP_389047
Pasteur: BG10791
BSORF: BG10791
UniProt: P25052 A0A6M4JF32 A0A085CAB8
Structure
PDB: 
2QCX 1TO9 1YAK 1TYH 1YAF

Position
1242449..1243159
AA seq 236 aa
MKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAA
YAKDLYTTGRMASHAQGTYEAEMALHREFAELLEISEEERKAFKPSPTAYSYTSHMYRSV
LSGNFAEILAALLPCYWLYYEVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFD
ELAENSTEEVRAKMKENFVISSYYEYQFWGMAYRKEGWSDSAIKEVEECGASRHNG
NT seq 711 nt   +upstreamnt  +downstreamnt
gtgaagttttcagaagaatgccgcagtgcagccgcagaatggtgggaggggagctttgtc
catccgttcgttcaaggaatcggtgacggaacgcttccgattgaccgttttaaatactac
gtacttcaggattcctattatttaacgcattttgcaaaggtgcagtcatttggtgccgct
tatgcgaaggatctttatacaacggggcggatggcaagccatgcccaaggtacatatgag
gcggaaatggcgcttcatcgcgagtttgccgagctgttggaaatcagcgaggaagagcgt
aaggcgtttaagccgtctcctacggcgtactcttatacatcccatatgtaccgttcggtt
ttgagcgggaatttcgcagaaatcttagcggccctgctgccatgctattggctctattac
gaggttggtgagaaattgctgcattgtgatccggggcatccaatttatcagaagtggatt
ggcacatatggcggtgattggtttagacaacaggtcgaggagcaaatcaaccgctttgat
gagctggcggaaaacagcacggaggaagtgcgtgccaagatgaaagagaattttgtcatc
tccagctactatgaatatcaattttggggaatggcctatcgaaaagaaggctggtctgac
agcgccataaaagaggtggaggaatgtggagcttcacgccataacggatga

DBGET integrated database retrieval system