KEGG   Bacillus subtilis subsp. subtilis 168: BSU11670
Entry
BSU11670          CDS       T00010                                 

Symbol
thiO
Name
(RefSeq) glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU11670 (thiO)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     BSU11670 (thiO)
SSDB
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Pyr_redox_3 Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox ApbA GIDA
Other DBs
NCBI-GeneID: 939377
NCBI-ProteinID: NP_389049
Pasteur: BG13147
BSORF: BG13147
UniProt: O31616 A0A6M3Z9P9 A0A0A1MD13
Structure
PDB: 
1RYI 1NG4 3IF9 1NG3

Position
1243735..1244844
AA seq 369 aa
MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEERD
AFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWY
SKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERD
GEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTL
YHDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAG
LRPGTKDGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKEVNQDWLHAFR
IDRKEAVQI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaaaggcattatgaagcagtggtgattggaggcggaattatcggttccgcaattgct
tattatttggcaaaggaaaacaaaaacaccgcattgtttgaaagcggaacaatgggcggc
agaacgacaagtgccgctgccggaatgctgggcgcccatgccgaatgcgaggaacgtgac
gcgttttttgatttcgctatgcacagtcagcgtctgtacaaaggtcttggagaagagctt
tatgcattatccggtgtggatatcaggcagcataacggcggtatgtttaagcttgcattt
tctgaagaagatgtgctgcagctgagacagatggacgatttggactctgtcagctggtat
tcaaaagaagaggtgttagaaaaagagccgtatgcgtctggtgacatctttggtgcatct
tttattcaggatgatgtgcatgtggagccttattttgtttgcaaggcatatgtgaaagca
gcaaaaatgcttggggcggagatttttgagcatacgcccgtcctgcatgtcgaacgtgac
ggtgaagccctgttcatcaagacccctagcggagacgtatgggctaatcatgttgtcgtt
gccagcggggtgtggagcggaatgttttttaaacagcttggactgaacaatgcttttctc
cctgtaaaaggggagtgcctgtccgtttggaatgatgatatcccgctgacaaaaacgctt
taccatgatcactgctatatcgtaccgagaaaaagcggaagactggttgtcggcgcgaca
atgaagccgggggactggagtgaaacaccggatcttggcggattggaatctgttatgaaa
aaagcaaaaacgatgctgccggctatacagaatatgaaggtggatcgtttttgggcggga
ctccgtccgggaacaaaggatggaaaaccgtacatcggcagacatcctgaggacagccgt
attttatttgcggctggccatttcagaaacgggatcctgcttgctcccgcaacgggcgct
ttgatcagtgatctcatcatgaataaagaggtcaaccaagactggctgcacgcattccga
attgatcgcaaggaggcggttcagatatga

DBGET integrated database retrieval system