KEGG   Bacillus subtilis subsp. subtilis 168: BSU11710
Entry
BSU11710          CDS       T00010                                 

Gene name
yjbV
Definition
(RefSeq) hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
bsu_M00899  Thiamine salvage pathway, HMP/HET => TMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU11710 (yjbV)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     BSU11710 (yjbV)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     BSU11710 (yjbV)
SSDB
Motif
Pfam: Phos_pyr_kin PfkB CbiX Carb_kinase
Other DBs
NCBI-GeneID: 936415
NCBI-ProteinID: NP_389053
Pasteur: BG13151
BSORF: BG13151
UniProt: O31620 A0A6M4JIQ6 A0A0A1LVI9
Position
1246837..1247652
AA seq 271 aa
MSIYKALTIAGSDSGGGAGIQADIKTFQELDVFGMSAITAVTAQNTLGVHGVHPLTVETL
RQQIDAVAEDLRPDAVKTGMLWNADMIEEVARKIDEYGFNRVIVDPVMIAKGGASLLRDE
SVATLKELLIPRSYAITPNVPEAETLTGMTISSLDDRKKAAEQLVKMGAQHVIIKGGHQP
EDNHITDLLFDGSMFMQITHPYINTKHTHGTGCTFAAALTAQTAKGDSIHQAFEVAANFV
REAVENTLGIGSGHGPTNHFAFKRNSLNTSR
NT seq 816 nt   +upstreamnt  +downstreamnt
atgagtatatataaagcattgacaatcgccggatcagattcaggcggcggcgcagggata
caggctgatattaaaacctttcaagagcttgatgtattcggaatgtctgcgattacggcg
gtaaccgctcaaaatacgcttggcgttcacggggtgcatccgctgactgtagagacgttg
agacagcaaattgacgctgttgctgaggatttgagaccggatgcagttaagacgggaatg
ctctggaatgccgacatgattgaagaagtggcaagaaaaattgacgagtacggattcaat
cgtgtaattgttgatccggttatgatcgcaaagggcggggcatccttgctgcgtgatgag
tcagttgccaccttaaaggagttgctcattccaagaagctacgcgattacgccgaatgtc
ccggaagcagaaacgctgacaggaatgacaatcagctcgctggatgaccggaaaaaagca
gcggagcagctcgtcaagatgggtgcgcagcatgtcattatcaaaggcgggcaccagcct
gaggacaatcacattactgaccttctttttgatggcagcatgtttatgcaaatcacccat
ccttatatcaatacgaagcatacgcatggcacaggctgcacctttgctgcggctttaacg
gcccaaacggctaaaggagacagcatccatcaggcatttgaggttgcggccaactttgtc
cgtgaagcggtggaaaatacgctcggcatcggatcgggacacgggccgacaaaccatttc
gcttttaaacgaaacagcttaaatacaagccgatga

DBGET integrated database retrieval system