KEGG   Bacillus subtilis subsp. subtilis 168: BSU11720
Entry
BSU11720          CDS       T00010                                 

Gene name
fabI
Definition
(RefSeq) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01212  Fatty acid metabolism
bsu01240  Biosynthesis of cofactors
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU11720 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU11720 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSU11720 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU11720 (fabI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BSU11720 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BSU11720 (fabI)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU11720 (fabI)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Other DBs
NCBI-GeneID: 939379
NCBI-ProteinID: NP_389054
Pasteur: BG13152
BSORF: BG13152
UniProt: P54616 A0A6M4JFB2
Structure
PDB: 
3OIG 3OIF

Position
1247788..1248564
AA seq 258 aa
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRND
SIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHN
ISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLG
KENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSR
GITGENLHVDSGFHITAR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaatttttcacttgaaggccgtaacattgttgtgatgggggtagccaacaaacgcagc
atcgcctggggcattgcgcgttctttacatgaagcgggtgcacgtttgattttcacatac
gctggtgaacgcctggagaaatccgttcacgagcttgccggaacattagaccgcaacgat
tccatcatcctcccttgcgatgttacaaacgacgcagaaatcgaaacttgcttcgcaagc
attaaggagcaggtcggtgtaatccacggtatcgcgcattgtatcgcgtttgccaacaaa
gaagagcttgtcggcgagtacttaaacacaaatcgtgacggcttccttttggctcataac
atcagctcatattctctgactgctgttgtcaaagcggcacgtccgatgatgactgaaggc
ggaagcattgtcactttgacgtaccttggcggagagcttgtgatgccaaactacaacgtc
atgggtgtagcaaaagcttctcttgatgcaagtgtgaaatatttagctgctgacttagga
aaagaaaatatccgcgtcaacagcatttctgccggcccgatcagaacattatctgctaaa
ggcatcagcgatttcaactctatcttaaaagacatcgaagagcgtgcaccgcttcgccgc
acgacaacacctgaagaagtgggcgatacagctgcgttcttgttcagcgatatgtcccgc
gggattacaggtgaaaatcttcacgttgattctggtttccatatcactgcccgctaa

DBGET integrated database retrieval system