KEGG   Bacillus subtilis subsp. subtilis 168: BSU11730
Entry
BSU11730          CDS       T00010                                 

Gene name
cotO
Definition
(RefSeq) spore coat protein O
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Spore_coat_CotO Borrelia_P83
Other DBs
NCBI-GeneID: 939810
NCBI-ProteinID: NP_389055
Pasteur: BG13153
BSORF: BG13153
UniProt: O31622 A0A6M3ZD08 A0A0A1HAW9
Position
1248665..1249348
AA seq 227 aa
MKMSNKKRNADKKPLMYIVQPDYAETTRSSMQEIVIKRKADKPAPPKAEEKPAYHEKQQE
EAVAQDVLQEDQKPAAEPVSQQTQEAREPENIKSQEEQKAEPQAVEETVEHEPPKAEKKE
EPALEARKPEKEPEAVHSADKAEEKAPPARKVKKPMSKMTIHEKIDFLTKLPHNMPRALC
LIEANGRTYRGVIVGRRNDSVLLRTTGNGAPTELAIDDITSLHPLGF
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaagatgtctaataagaaaagaaacgcggataaaaaaccgctcatgtatattgttcag
ccggattatgcagaaactacaaggtcatccatgcaggagattgtcatcaaaagaaaggcc
gacaaacccgctccgccaaaagctgaggaaaagccggcttaccatgagaagcagcaggag
gaagccgtggcacaggatgtcctgcaagaagaccaaaagcctgcagccgaaccagtgagt
cagcaaacacaagaggcgagagagccagagaacataaaaagccaagaggaacagaaggca
gagccgcaggccgtagaagaaaccgttgaacacgagcccccgaaagcagaaaaaaaggaa
gagcctgcacttgaggcccggaagcctgagaaagaaccggaagctgtccatagtgctgat
aaagcggaggaaaaagcaccgccggcacgaaaagtgaaaaaaccgatgagcaagatgacg
atccacgaaaaaattgattttttaacaaagctgcctcataacatgccgagagcgctttgt
ttgattgaagccaatggaagaacgtacaggggcgtgattgtcggaagaagaaatgattcc
gtcctgcttcgaacaaccggaaacggagccccaaccgaactggcaatcgatgatattacc
tctttgcacccgctcggtttttaa

DBGET integrated database retrieval system