KEGG   Bacillus subtilis subsp. subtilis 168: BSU11740
Entry
BSU11740          CDS       T00010                                 

Symbol
cotZ
Name
(RefSeq) spore coat protein Z
  KO
K06344  spore coat protein Z
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU11740 (cotZ)
SSDB
Motif
Pfam: Spore-coat_CotZ
Other DBs
NCBI-GeneID: 936418
NCBI-ProteinID: NP_389056
Pasteur: BG10499
BSORF: BG10499
UniProt: Q08312 A0A6M4JKJ3 A0A0A1M1X9
Position
complement(1249442..1249888)
AA seq 148 aa
MSQKTSSCVREAVENIEDLQNAVEEDCPTGCHSKLLSVSHSLGDTVPFAIFTSKSTPLVA
FGNVGELDNGPCFNTVFFRVERVHGSCATLSLLIAFDEHKHILDFTDKDTVCEVFRLEKT
NYCIEVDLDCFCAINCLNPRLINRTHHH
NT seq 447 nt   +upstreamnt  +downstreamnt
atgagccagaaaacatcaagctgcgtgcgtgaagctgtagaaaatattgaagatctgcaa
aacgctgttgaagaagactgcccgaccggctgccactctaagcttttatctgtaagccat
tcgttaggcgacacagtgccttttgcaatatttacatcaaaatcaacgccattagtcgcc
ttcggaaatgtcggcgaactcgataacggcccttgctttaatacagtatttttcagggtc
gaaagagtgcatggaagctgtgcaacactgtcattattaatcgcatttgacgaacacaaa
cacattttggacttcaccgataaagatacggtgtgtgaagtgttccgactcgaaaaaacg
aactactgtattgaagttgacttagactgcttctgcgcaatcaactgcttaaatcctcga
ttaatcaatcgtacacatcatcattaa

DBGET integrated database retrieval system