KEGG   Bacillus subtilis subsp. subtilis 168: BSU11750Help
Entry
BSU11750          CDS       T00010                                 

Gene name
cotY
Definition
(RefSeq) spore coat protein Y
  KO
K06343  spore coat protein Y
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU11750 (cotY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore-coat_CotZ GPR15L
Motif
Other DBs
NCBI-GeneID: 939383
NCBI-ProteinID: NP_389057
Pasteur: BG10498
BSORF: BG10498
UniProt: Q08311 A0A0A1MB04
Position
complement(1250016..1250504)
Genome map
AA seq 162 aa AA seqDB search
MSCGKTHGRHENCVCDAVEKILAEQEAVEEQCPTGCYTNLLNPTIAGKDTIPFLVFDKKG
GLFSTFGNVGGFVDDMQCFESIFFRVEKLCDCCATLSILRPVDVKGDTLSVCHPCDPDFF
GLEKTDFCIEVDLGCFCAIQCLSPELVDRTSPHKDKKHHHNG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcggaaaaacccatggccggcatgagaactgtgtatgcgatgcagtggaaaag
attttagcagagcaggaggcagttgaagaacagtgtccgactggctgctataccaacctt
ttaaaccctacgattgctggaaaagacacaattccgtttctcgtttttgataaaaaaggc
ggattgttctccacattcggaaacgtagggggatttgtggatgatatgcaatgctttgaa
tccattttcttccgcgtcgaaaaattatgcgattgctgtgcaacactgtctattttacgc
ccggtcgatgtcaaaggcgataccttaagtgtttgccacccttgcgacccggatttcttc
gggctagaaaaaacagatttctgcattgaagtggatctcggatgcttctgcgcgattcag
tgcctgtcaccagagctagttgacagaacatcgcctcacaaagataaaaagcatcatcac
aatggataa

DBGET integrated database retrieval system