KEGG   Bacillus subtilis subsp. subtilis 168: BSU11799
Entry
BSU11799          CDS       T00010                                 

Gene name
yjzK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: KxDL XhlA
Other DBs
NCBI-GeneID: 8303173
NCBI-ProteinID: YP_003097704
UniProt: C0H3Y7 A0A6M4JGZ9
Position
1252815..1253021
AA seq 68 aa
MNEFEKWIEGRYEPHEQKQKEHEDTMGSIRKDLDAFDKAGLEFEDEIEELAEKTEALLKK
HQAQYDQS
NT seq 207 nt   +upstreamnt  +downstreamnt
gtgaatgagtttgaaaaatggatagaaggaagatatgaaccacatgaacaaaagcaaaaa
gagcatgaagacacgatgggcagtatcagaaaagacttggatgcatttgataaagccggt
ctggaatttgaagatgagattgaagagctggctgaaaaaacggaggccttacttaaaaaa
catcaagctcaatatgatcaatcgtaa

DBGET integrated database retrieval system