KEGG   Bacillus subtilis subsp. subtilis 168: BSU11810
Entry
BSU11810          CDS       T00010                                 

Gene name
spoVIF
Definition
(RefSeq) sporulation-specific transcription factor SpoVIF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SpoVIF EnY2 Ribonuc_red_2_N DUF4287
Other DBs
NCBI-GeneID: 939384
NCBI-ProteinID: NP_389063
Pasteur: BG13156
BSORF: BG13156
UniProt: O31625 A0A6M4JFC4
Position
1253385..1253639
AA seq 84 aa
MDNQFFKNIEKKTGVKMQDVMNLAGSLQNANFKDENTVRSVINRVAQMANRRVPKELEDK
IVESITSGKEKLDFGTISKMMDNK
NT seq 255 nt   +upstreamnt  +downstreamnt
atggataatcaattttttaagaacatcgaaaagaaaacaggtgtgaagatgcaggatgta
atgaatcttgccggatcactccaaaacgctaattttaaagatgaaaatacagtgcgcagt
gtgattaaccgcgtagcgcagatggcaaacagacgcgtgccaaaagaattagaagataaa
attgtggaatctattacaagcggaaaagaaaagcttgattttggcacgatttctaaaatg
atggataataaataa

DBGET integrated database retrieval system