KEGG   Bacillus subtilis subsp. subtilis 168: BSU11839
Entry
BSU11839          CDS       T00010                                 

Gene name
yjzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zf-C2HE DUF5683
Other DBs
NCBI-GeneID: 8303175
NCBI-ProteinID: YP_003097706
UniProt: C0H3Y9 A0A6M3ZD17
Position
1256109..1256363
AA seq 84 aa
MIYAGQIQNQQYAQYANRTIGHKQDYAGTEKISYVPFQRVYKELEKQQENQTAAERKVNE
MKRKRSLYKRLREKGMGTYINRYV
NT seq 255 nt   +upstreamnt  +downstreamnt
atgatatatgcaggtcaaattcagaaccagcaatacgctcaatatgctaatagaacgatt
ggacataagcaggattatgccggaaccgaaaaaatcagctatgtcccgtttcagcgggta
tacaaagaactggaaaagcagcaggagaatcaaacggcagctgaaagaaaagtaaacgag
atgaaacgtaagcgctctctttataagagattgcgagaaaaaggaatggggacatatatt
aatcgatatgtataa

DBGET integrated database retrieval system