KEGG   Bacillus subtilis subsp. subtilis 168: BSU11840
Entry
BSU11840          CDS       T00010                                 

Gene name
yjcF
Definition
(RefSeq) N-acetyltransferase YjcF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_9 Acetyltransf_5
Other DBs
NCBI-GeneID: 939387
NCBI-ProteinID: NP_389066
Pasteur: BG13159
BSORF: BG13159
UniProt: O31628 A0A6M3Z9W3
Structure
PDB: 
1Q2Y

Position
complement(1256436..1256858)
AA seq 140 aa
MKAVIAKNEEQLKDAFYVREEVFVKEQNVPAEEEIDELENESEHIVVYDGEKPVGAGRWR
MKDGYGKLERICVLKSHRSAGVGGIIMKALEKAAADGGASGFILNAQTQAVPFYKKHGYR
VLSEKEFLDAGIPHLQMMKD
NT seq 423 nt   +upstreamnt  +downstreamnt
ttgaaagcagttatcgcaaaaaatgaagaacaactgaaagatgcattctatgtaagagaa
gaagtctttgtcaaagaacaaaacgtgcctgctgaagaagaaattgacgaacttgaaaat
gagtcagagcatatcgtcgtgtatgacggtgaaaagcctgtcggtgccggaagatggcgc
atgaaggacggctacggcaagttagagcggatttgcgtactgaaaagccaccgctcagcc
ggtgtcggcggcatcattatgaaagcgctcgaaaaagccgcggcagacggaggcgcttcc
ggtttcattttaaacgcgcaaacacaggctgtgccgttttacaagaaacacgggtatcgc
gtgctttctgaaaaagaattcctcgatgccggcattccgcacttacaaatgatgaaggac
tga

DBGET integrated database retrieval system