KEGG   Bacillus subtilis subsp. subtilis 168: BSU11860
Entry
BSU11860          CDS       T00010                                 

Gene name
yjcH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Esterase DUF5838 Hydrolase_4
Other DBs
NCBI-GeneID: 936425
NCBI-ProteinID: NP_389068
Pasteur: BG13161
BSORF: BG13161
UniProt: O31630 A0A6M4JH42
Position
complement(1257414..1258136)
AA seq 240 aa
MAPKNGTVQEKKFFSKELNEEMTLLVYLPSNYSPLYKYHVIIAQDGHDYFRLGRIGRQVE
ELLSKREIDRSIIIGVPYKDVKERRNTYHPEGSKFSAYKRFIAHELVPFADDEYPTYQIG
YGRTLIGDSLGATVSLMTALDYPNMFGNIIMQSPYVDKHVLEAVKQSDDIKHLSIYHQIG
TKETDVHTTDGNILDFTEPNRELKQLLEKKLSDYDFEPFDGDHKWTYWQPLITPALKKML
NT seq 723 nt   +upstreamnt  +downstreamnt
atggcaccgaaaaacggcacagtgcaagaaaagaaattcttttcaaaagagcttaacgag
gaaatgaccttgcttgtttatctgccgtccaactactccccgctttataaataccatgtc
attatcgcgcaggacggccacgattatttcaggctggggagaatcggcagacaggttgag
gaattgctgtcgaaacgcgaaatagaccggagcattattatcggtgttccctataaggat
gtaaaagagcgcagaaacacttatcatccggagggttcaaaattttcggcttataaacgg
ttcatcgcccatgagctcgttccttttgcagatgatgagtatccaacctatcagatcggt
tacggccgaacgctgatcggtgattcgctcggagcaaccgtgtcacttatgacagcgctt
gattatccgaatatgtttggcaacatcatcatgcagtctccctatgttgacaaacacgta
ctagaagccgtaaaacagtcagacgatatcaaacacctctctatttatcaccaaatcgga
acaaaagaaactgacgtccacacgacagacgggaacattctggactttacagaaccgaac
cgggagctgaaacagctgctggagaaaaagctttccgattatgatttcgagccatttgac
ggagaccacaaatggacatactggcagccgctcatcaccccggcgctgaaaaaaatgctt
taa

DBGET integrated database retrieval system