KEGG   Bacillus subtilis subsp. subtilis 168: BSU11870
Entry
BSU11870          CDS       T00010                                 

Gene name
yjcI
Definition
(RefSeq) cystathionine gamma-synthase/O-acetylhomoserine
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00450  Selenocompound metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU11870 (yjcI)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU11870 (yjcI)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU11870 (yjcI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     BSU11870 (yjcI)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 GDC-P Met_gamma_lyase
Other DBs
NCBI-GeneID: 939812
NCBI-ProteinID: NP_389069
Pasteur: BG13162
BSORF: BG13162
UniProt: O31631 A0A6M4JRI7
Position
1258492..1259613
AA seq 373 aa
MSQHVETKLAQIGNRSDEVTGTVSAPIYLSTAYRHRGIGESTGFDYVRTKNPTRQLVEDA
IANLENGARGLAFSSGMAAIQTIMALFKSGDELIVSSDLYGGTYRLFENEWKKYGLTFHY
DDFSDEDCLRSKITPNTKAVFVETPTNPLMQEADIEHIARITKEHGLLLIVDNTFYTPVL
QRPLELGADIVIHSATKYLGGHNDLLAGLVVVKDERLGEEMFQHQNAIGAVLPPFDSWLL
MRGMKTLSLRMRQHQANAQELAAFLEEQEEISDVLYPGKGGMLSFRLQKEEWVNPFLKAL
KTICFAESLGGVESFITYPATQTHMDIPEEIRIANGVCNRLLRFSVGIEHAEDLKEDLKQ
ALCQVKEGAVSFE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtcacagcacgttgaaacgaaattagctcaaattgggaaccgtagcgatgaagtcacg
ggaacagtgagtgctcctatctatttatcaacagcataccgccacagagggatcggagaa
tctaccggatttgattatgtccgcacaaaaaatccgacacgccagcttgttgaggacgcg
atcgctaacttagaaaacggcgcgagagggcttgcctttagttcgggaatggctgctatc
caaacgattatggcgctgtttaaaagcggagatgaactgatcgtttcatcggacctatat
ggcggcacgtaccgtttatttgaaaatgaatggaaaaaatacggattgacttttcattat
gatgatttcagcgatgaggactgtttacgctctaagattacgccgaatacaaaagcggtg
tttgtggaaacgccgacaaaccccctcatgcaggaggcggacattgaacatattgcccgg
attacaaaggagcacggtcttctgctgatcgtagataatacattttatacaccggtcttg
cagcggccgcttgagctgggagctgacattgtcattcacagcgcaaccaagtatttaggc
gggcataacgatctgcttgctggacttgtcgtggtgaaggatgagcggctcggagaggaa
atgtttcagcatcaaaatgcaatcggcgccgtcctgccgccatttgattcgtggcttctg
atgagaggaatgaagacgctgagcctcagaatgcgccagcatcaggcaaacgcgcaggag
cttgcggcgtttttagaagagcaggaagaaatttcggatgtgctgtatcccggaaaaggc
ggcatgctgtccttccgtctgcaaaaagaagaatgggtcaatccgtttttaaaagcactg
aagaccatttgttttgcagaaagcctcggcggggtggaaagctttattacataccctgcg
acccagacgcacatggatattcctgaagagatccgcatcgcaaacggggtgtgcaatcgg
ttgctgcgcttttctgtcggtattgaacatgcggaagatttaaaagaggatctaaaacag
gcattatgtcaggtcaaagagggagctgtttcatttgagtaa

DBGET integrated database retrieval system