KEGG   Bacillus subtilis subsp. subtilis 168: BSU11880
Entry
BSU11880          CDS       T00010                                 

Symbol
yjcJ
Name
(RefSeq) cystathionine beta-lyase MetC
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00450  Selenocompound metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU11880 (yjcJ)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU11880 (yjcJ)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     BSU11880 (yjcJ)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 GDC-P
Other DBs
NCBI-GeneID: 936424
NCBI-ProteinID: NP_389070
Pasteur: BG13163
BSORF: BG13163
UniProt: O31632 A0A6M3Z9X5
Position
1259606..1260778
AA seq 390 aa
MSKHNWTLETQLVHNPFKTDGGTGAVSVPIQHASTFHQSSFEEFGAYDYSRSGTPTRTAL
EETIAALEGGTRGFAFSSGMAAISTAFLLLSQGDHVLVTEDVYGGTFRMVTEVLTRFGIE
HTFVDMTDRNEVARSIKPNTKVIYMETPSNPTLGITDIKAVVQLAKENGCLTFLDNTFMT
PALQRPLDLGVDIVLHSATKFLSGHSDVLSGLAAVKDEELGKQLYKLQNAFGAVLGVQDC
WLVLRGLKTLQVRLEKASQTAQRLAEFFQKHPAVKRVYYPGLADHPGAETHKSQSTGAGA
VLSFELESKEAVKKLVENVSLPVFAVSLGAVESILSYPATMSHAAMPKEEREKRGITDGL
LRLSVGVEHADDLEHDFEQALKEIAPVSVR
NT seq 1173 nt   +upstreamnt  +downstreamnt
ttgagtaaacacaattggacgctggaaacccagctcgtgcacaatccatttaaaacagac
ggcggaaccggggcagtcagtgtaccgattcagcacgcctcgacttttcaccaatcttca
tttgaagagttcggggcatatgattacagccgctctggcacgccgacaagaacagctctc
gaagaaacaattgccgcactggaaggcggaacaagaggatttgctttcagttcaggcatg
gctgccatctcaacagcatttttactgctgtcacagggtgatcacgttcttgtgacagaa
gatgtatacggcggaaccttccgtatggtgacagaggtgctgacccggtttggcattgag
catacgtttgtcgacatgacggatcgtaatgaagtggcgcggagcatcaagccgaacaca
aaggtcatttatatggagacgccatcaaatccgacacttgggattacggatattaaagca
gttgttcagcttgcaaaagaaaacggctgcctgacctttctggacaatacattcatgacg
ccggcactgcagcgtccgcttgatctcggcgtggatattgtacttcacagcgcgacaaaa
ttcttaagcggacacagcgatgtgctctcaggtttggctgctgtcaaagatgaagagctt
gggaagcagctgtataagctacaaaacgcgttcggcgccgtccttggcgtgcaagattgc
tggcttgtcctgcgcggattaaaaacattgcaggtccgtttagagaaagcgagtcaaaca
gctcagcggcttgcggaatttttccagaagcacccggcggtcaagcgcgtgtattatccg
ggactggctgatcatcccggcgctgaaacccataaaagccagtcaacgggagcgggcgcc
gtgctatcttttgagcttgaaagcaaagaggccgttaagaagttagtcgagaatgtgtca
ctcccagtcttcgctgtcagccttggcgccgtggaatcgattttgtcctatccggcaacg
atgtctcatgcggcaatgcctaaggaagagcgtgaaaaacgcggtatcactgatggcctg
ctccgtctgagtgtcggcgtcgaacatgcagacgatttagaacacgatttcgaacaagcg
ctgaaagaaattgctccagtttcggttcgttaa

DBGET integrated database retrieval system