KEGG   Bacillus subtilis subsp. subtilis 168: BSU11890Help
Entry
BSU11890          CDS       T00010                                 

Gene name
yjcK
Definition
(RefSeq) ribosomal-protein-alanine acetyltransferase
  KO
K03790  [ribosomal protein S5]-alanine N-acetyltransferase [EC:2.3.1.267]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU11890 (yjcK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.267  [ribosomal protein S5]-alanine N-acetyltransferase
     BSU11890 (yjcK)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  ribosomal protein modification factors
   BSU11890 (yjcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_4 Acetyltransf_1 Acetyltransf_8
Motif
Other DBs
NCBI-GeneID: 939406
NCBI-ProteinID: NP_389071
Pasteur: BG13164
BSORF: BG13164
UniProt: O31633
Position
complement(1260811..1261356)
Genome map
AA seq 181 aa AA seqDB search
MLKGKTIYVRPLEVTDAEENLGLQSENRDFFEQFSMIRADDYYTVEGQRKRITEYQERLE
KDEEYHFGIFTASDDRLIGTVSLFQIIRGALQTAFIGYFLDKAHNGKGIMTEAVRLVVDY
AFHELKLHRIEAGVMPRNLGSMRVLEKAGFHKEGIARKNVKINGVWEDHQVLAILNPDDE
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggaaaaaccatttatgttagacctttagaagtaacggatgccgaagaaaat
ctggggctgcaaagcgaaaatcgagattttttcgaacagttttctatgatacgcgcagac
gattactatacggttgaggggcaaagaaaacgaataaccgagtatcaggaaagacttgag
aaagatgaagaatatcattttggcatctttacagcgtcagacgatagattaatcgggacg
gtttcgctctttcaaatcatccgtggcgcgctgcaaactgcgttcatcgggtatttttta
gacaaagcccataatggaaagggcattatgacagaggcagtcagattggttgttgattat
gcgttccacgaattgaaactgcatcggattgaagccggtgtgatgccccgtaatctcggg
tccatgcgtgttttagaaaaagcgggatttcataaagaaggcatcgcccgaaaaaatgta
aaaattaatggcgtttgggaggatcatcaagtcctcgcgattctgaatcctgatgacgaa
caataa

DBGET integrated database retrieval system