KEGG   Bacillus subtilis subsp. subtilis 168: BSU11900
Entry
BSU11900          CDS       T00010                                 

Symbol
yjcL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF819
Other DBs
NCBI-GeneID: 936434
NCBI-ProteinID: NP_389072
Pasteur: BG13165
BSORF: BG13165
UniProt: O31634 A0A6M3Z9H3
Position
complement(1261426..1262616)
AA seq 396 aa
MHSLISSDDVWVLWGFIAVWAAVSIGLEQRFKWASAVSGAIIALAGAMVFTNVGVLPVES
PVYDTVWSYVVPLAIPLLLFQINVRQIFKESRRLLFIFLISSVGTVLGSILAFFLLKQHI
PYLDKIGGMISASYIGGGVNFAAMAAKFETPGEYVSATVVADNFMMALLFFILISIPALK
WFQRHYAMPFEEKVKADGNSGNSAESYWKRKDISLKDIAFNAGAAFALVAVSMKVSGYFK
SIFSHPLLTGTLGDQYLVLTSLTVLIIFLFPRFFERLNGSQELGTFLIYLFFVVIGIPAD
LRLIVTNAPLILLFVFIIAISNLAVSLAAGKLFRVRLEEILLAVNATVGGPTTAAAMAIA
KGWRELVAPIMLVGTLGYLIGNYVGTFMGNWFSSFL
NT seq 1191 nt   +upstreamnt  +downstreamnt
ttgcattctttgatttcttctgatgatgtatgggtattatgggggtttattgcggtgtgg
gcggcagtgagcatcgggctggagcagcgctttaagtgggcgtctgctgtgtcgggcgct
attatcgcccttgcaggtgctatggtgtttacaaatgtaggagtgcttcctgttgagtcg
cccgtgtatgacactgtgtggtcttatgtggtaccgctggcgataccacttttattgttt
cagatcaatgttaggcaaatttttaaggaaagcaggcgtttgctgtttatttttctgatt
agctccgttggaacagtgcttggcagtatcctggctttttttctactcaaacagcatatt
ccttacttagataaaatcggtgggatgatcagcgcctcttatatcggcggcggggtcaac
tttgcggcgatggcggcaaaatttgagacgcctggtgaatatgtgtcggctaccgttgtg
gctgataattttatgatggcgcttttgttttttattttaatcagcattcctgcactcaaa
tggtttcagcggcattatgccatgccgtttgaagagaaggtaaaagccgatggaaacagc
ggaaacagtgctgaaagctattggaaacggaaggatatttccttaaaggatatcgctttt
aatgccggtgccgctttcgcgcttgttgcggttagtatgaaggtttccggttattttaaa
agcattttttctcatcccctgctgaccggtacgcttggcgatcagtacctggttcttacg
tctttaactgttcttatcatttttcttttcccgcgtttttttgaaaggctcaatggatct
caggagcttggaacctttttgatttatttgttttttgtggtgatcggcattcctgcagat
ctccgcttaatcgtcacgaatgcgcctcttattctattattcgtgtttatcattgcgatt
agcaatttagcggtttccttagctgccggaaaattgttccgtgtgcggcttgaagaaatt
ctgctcgccgtcaacgctactgtcgggggaccgacgactgcggctgcgatggcaattgcc
aagggatggcgggagcttgtcgccccgatcatgcttgtcggtacgctcggctacttaatc
ggcaactatgttggcacttttatgggaaattggttttcttccttcttataa

DBGET integrated database retrieval system