KEGG   Bacillus subtilis subsp. subtilis 168: BSU11910
Entry
BSU11910          CDS       T00010                                 

Gene name
yjcM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Amidase_6
Other DBs
NCBI-GeneID: 939395
NCBI-ProteinID: NP_389073
Pasteur: BG13166
BSORF: BG13166
UniProt: O31635 A0A6M4JIS7
Position
complement(1263702..1264931)
AA seq 409 aa
MKKELLASLVLCLSLSPLVSTNEVFAATTNKETKENVSITNEIGYEKVKDMLEQQKYDFE
HNTPLAHPKESKLTDSDEGVLLYSALSKVDKQKFHEFTYDIDDVKTSEKNNKLIVEAYIT
RNFVFGVEKVTTSLGDNIKLEIPKTTSNKQSSQSTNTSNLSFSQVKNSSNQLNVIPLSNS
SKQLNVTQLNNSSSTLQYENDEEYSSDVKLDEFLKKYKQEVKNDDKEEVKSEDKPVSMNF
NAANSNQLTVTATSVKGYSGYAAMKYAEKYALKPNKNYKYYKDKDCTNFVSQALRAGRMP
YFKEWKPYTDAWVNAGAFRSYILKAGGIKMKTVSDTYSNVKLGDVYHYDYHNKIGLRYAD
GWMDHTAIVTSRANMKLYVSYHSTNRLNVPREYVTSKEGGKRYVSSIRN
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaaaaaagaattacttgcttcactagttttatgtctatcattgtcaccattagtgtca
acaaatgaagtttttgcagccactactaataaagagactaaagaaaatgtttcaattacc
aacgagattggttacgaaaaagttaaggatatgttagaacaacaaaaatatgattttgaa
cacaacactcctttagcgcatcctaaagagtctaaattgactgattccgacgaaggagtc
ttactgtattctgcgttaagtaaagtggacaaacaaaaattccacgagtttacatacgat
atagacgatgttaagacttctgaaaaaaacaataagctaattgttgaagcttatattact
cgaaactttgtttttggtgttgaaaaagtaacaacatctctgggcgataatattaaactt
gaaattcccaaaacaacttctaataaacaaagttctcaatcaacaaatacttctaatcta
agtttctctcaagttaaaaattcttctaatcaactaaatgtaataccattgagtaattct
tctaagcaactaaatgtaacacaattaaataattcttcttcaactctacaatatgaaaat
gatgaagaatattcttcggatgttaaattagatgaatttttaaaaaaatataagcaagaa
gtgaaaaatgatgataaagaagaagtgaaaagtgaagataaaccagtaagtatgaacttc
aatgctgctaactctaatcaactaactgtgactgcaacatctgttaaaggatatagtggt
tacgctgcaatgaaatatgcagaaaaatatgccttaaaaccaaataaaaactataaatat
tataaagacaaagattgtactaactttgtttcccaagcattaagagctggaagaatgccg
tactttaaagaatggaaaccctatacagatgcttgggttaatgcaggagcctttagatca
tacattttaaaagctggcggaataaaaatgaagactgtttctgatacatattcaaatgta
aagcttggagatgtatatcactatgattaccataataaaataggtcttcgctatgctgat
ggttggatggatcatacggctatcgtaacgagccgagcaaatatgaaactttatgtaagt
tatcattctaccaatagacttaatgttcctcgagaatatgttacttctaaggaaggcgga
aaacggtatgtttctagtattcgcaattaa

DBGET integrated database retrieval system