KEGG   Bacillus subtilis subsp. subtilis 168: BSU11920
Entry
BSU11920          CDS       T00010                                 

Gene name
yjcN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Wzy_C
Other DBs
NCBI-GeneID: 939817
NCBI-ProteinID: NP_389074
Pasteur: BG13167
BSORF: BG13167
UniProt: O31636 A0A6M3Z9I5
Position
1265057..1265377
AA seq 106 aa
MKKKTKIILSLLAALIVILIVLPVLSPVVFTASSEKGAIRHEIYKRGYPYQSYFAVLQKR
EGDNESGNLYYVNWLDWKDETGQTPHLCYSKKSSDGEYEVSCGTGP
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaaaaagaaaactaaaattatactttctctcttggcagcacttattgttatattgata
gtacttccagttctatctcctgttgtctttacagcttcttcggaaaaaggagcaatcaga
cacgaaatttataaaagaggatatccctaccaaagctactttgcagttctccagaaaaga
gaaggagacaatgaatctgggaatctttattatgtaaattggctagattggaaagatgaa
acagggcaaactcctcacttatgctattcgaaaaaatcatcagatggtgaatacgaagta
agttgtggcacagggccgtaa

DBGET integrated database retrieval system