KEGG   Bacillus subtilis subsp. subtilis 168: BSU11928
Entry
BSU11928          CDS       T00010                                 

Gene name
yjzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303198
NCBI-ProteinID: YP_003097707
UniProt: C0H3Z0 A0A6M3Z9K5
Position
1265530..1265661
AA seq 43 aa
MKQSKKKPSQKQHERLDRFWQQMMNTNMQTLRRGKGGAYKRRK
NT seq 132 nt   +upstreamnt  +downstreamnt
atgaaacagtccaaaaagaaaccatcacagaagcaacatgagcgcttagatcgtttctgg
caacaaatgatgaacactaacatgcaaacactcagacgtggcaaaggcggcgcttataaa
cgcagaaagtaa

DBGET integrated database retrieval system