KEGG   Bacillus subtilis subsp. subtilis 168: BSU11929
Entry
BSU11929          CDS       T00010                                 

Gene name
yjzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303177
NCBI-ProteinID: YP_003097708
UniProt: C0H3Z1 A0A6M4JKL2
Position
1265677..1265850
AA seq 57 aa
MMKNGFAYKNGKLVNIFCGKEELYNELKAFLVKTFSINVKEVSRPSIYRRTKSKQLE
NT seq 174 nt   +upstreamnt  +downstreamnt
atgatgaaaaacggattcgcttataaaaacggaaagcttgtgaatatcttttgcggcaaa
gaagagctctataacgagttgaaagccttcttggtcaaaaccttcagtatcaacgtgaaa
gaggtatcgaggccctcaatatatcgcagaacaaaaagcaaacaactggaatga

DBGET integrated database retrieval system