KEGG   Bacillus subtilis subsp. subtilis 168: BSU11930
Entry
BSU11930          CDS       T00010                                 

Gene name
yjcO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sigma70_r4 HTH_23 HTH_28 Sigma70_r4_2 HTH_38 HTH_31 Phage_antitermQ HTH_7 GerE KORA Sigma70_ECF HTH_29 Phage_NinH NUMOD1 HTH_11 HTH_Tnp_ISL3
Other DBs
NCBI-GeneID: 936430
NCBI-ProteinID: NP_389075
Pasteur: BG13168
BSORF: BG13168
UniProt: O31637 A0A6M4JF12
Position
1265887..1266348
AA seq 153 aa
MTDQMIAWEIEEWIRDYKFMLREIKRLNRVLNKVDFISTKLTATYGEEAGMPRGSAGVSQ
AELRQMDRRERRLHKYESIVHYLDNAMEHIEEEKHRIVYDCMMEGMSYTAIANHLDCSRD
TIRKIKTAIIGNIVNKVKEANFLQYLNSFKSAV
NT seq 462 nt   +upstreamnt  +downstreamnt
atgacagatcaaatgattgcatgggagattgaggaatggattcgtgattataaattcatg
ctgcgggagatcaaaaggctcaaccgtgtattaaacaaagtggattttattagcacaaag
ctcactgcaacatacggggaggaagcgggcatgccaaggggatcagcaggcgtcagtcag
gcagaattgcggcagatggaccgaagagaaaggcggcttcacaaatatgaatctattgtg
cattacctggacaatgcaatggaacacattgaagaagaaaagcaccgaatcgtttacgat
tgcatgatggaaggcatgagctacactgctattgcaaaccaccttgattgctcccgggat
accatcagaaagatcaaaacagccataatcggcaacatcgtcaataaagtcaaagaagcc
aactttctgcaatatttgaattcgtttaaatcggcggtgtaa

DBGET integrated database retrieval system