KEGG   Bacillus subtilis subsp. subtilis 168: BSU11940
Entry
BSU11940          CDS       T00010                                 

Gene name
yjcP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nup188 MCM3AP_GANP
Other DBs
NCBI-GeneID: 936429
NCBI-ProteinID: NP_389076
Pasteur: BG13169
BSORF: BG13169
UniProt: O31638 A0A6M3ZEU9
Position
1266614..1267117
AA seq 167 aa
MKKQKNNKKKNIEKRNIEKRNIEEKNNEDLEELENAIYTYHKKELLAFFLEKTRIGHDKE
EYKRFQSLLYKLDIECLEFAISRFSHIDIIHDHSKYVPAFIPLFAAYLTMFFNFYEKHWG
ALSFAAGTIAAIVWIIAVERKHRNQAISIMKIFEQVKERKVKDRSKD
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaaaaacagaaaaataataaaaagaagaatattgaaaagcgaaatattgaaaagcga
aatattgaagagaagaataatgaggacttagaagaactggaaaatgcgatttatacttat
cacaaaaaggagctacttgctttctttcttgaaaaaactcgaattggtcatgataaggaa
gaatacaaaaggttccaatctcttctttataagttggatattgaatgtttagaatttgct
atatcgagattttctcatatagatattatccatgatcattcaaaatatgttccagccttt
atccctttatttgcagcatatctcaccatgttctttaatttttatgaaaaacattgggga
gctttatcttttgctgctggtacaattgctgctattgtttggataattgcagtagaaaga
aaacatagaaatcaagcaatttctattatgaaaatatttgaacaagtcaaagagagaaaa
gtgaaagacagatctaaagactga

DBGET integrated database retrieval system