KEGG   Bacillus subtilis subsp. subtilis 168: BSU11950
Entry
BSU11950          CDS       T00010                                 

Gene name
yjcQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YjcQ EFP DUF2513 NTP_transf_5
Other DBs
NCBI-GeneID: 939821
NCBI-ProteinID: NP_389077
Pasteur: BG13170
BSORF: BG13170
UniProt: O31639 A0A6M4JH51
Structure
PDB: 
2HGC

Position
1267129..1267413
AA seq 94 aa
MNKDKLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYK
LGPELTEKGENYLKENGTWSKAYKTIKEIKDWIK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaataaggataaattaaggtatgcaatcttaaaagaaatttttgaaggtaatacccct
ttgtcagaaaacgatattggagttactgaagatcaatttgatgatgctgtgaacttttta
aaacgcgaagggtatatcattggggtccattattcagatgatagacctcatttatacaaa
ttaggacctgaactgacagagaaaggtgaaaactacttgaaagagaatggaacatggtct
aaggcctataagaccattaaagagattaaagattggattaaataa

DBGET integrated database retrieval system