KEGG   Bacillus subtilis subsp. subtilis 168: BSU11970
Entry
BSU11970          CDS       T00010                                 

Gene name
yjcS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ABM DUF1931
Other DBs
NCBI-GeneID: 939400
NCBI-ProteinID: NP_389079
Pasteur: BG13172
BSORF: BG13172
UniProt: O31641 A0A6M3Z9T1
Structure
PDB: 
1Q8B

Position
1268275..1268592
AA seq 105 aa
MKSHKMMGGGISMHYITACLKIISDKDLNEIMKEFKKLEEETNKEEGCITFHAYPLEPSE
RKIMLWEIWENEEAVKIHFTKKHTIDVQKQELTEVEWLMKSNVND
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaaaagccataaaatgatgggagggggaatttcgatgcattacataacggcatgttta
aaaatcatcagtgataaagaccttaatgagataatgaaggaattcaaaaaacttgaggaa
gaaacgaacaaagaagagggttgtattacattccatgcttatccgcttgagccatcagaa
cgtaaaataatgctttgggagatttgggaaaacgaagaagctgtgaaaatccatttcaca
aaaaaacacacaatagacgttcaaaaacaagaattaacggaagtagaatggttaatgaaa
agcaatgtgaatgattga

DBGET integrated database retrieval system